BLASTX nr result
ID: Panax24_contig00028860
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028860 (400 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010101516.1 Ankyrin repeat-containing protein [Morus notabili... 60 8e-08 OIW06819.1 hypothetical protein TanjilG_03714 [Lupinus angustifo... 59 1e-07 XP_019452558.1 PREDICTED: ankyrin repeat-containing protein ITN1... 59 1e-07 XP_019452557.1 PREDICTED: ankyrin repeat-containing protein ITN1... 59 1e-07 XP_018836507.1 PREDICTED: ankyrin repeat-containing protein ITN1... 58 3e-07 XP_008463527.1 PREDICTED: ankyrin repeat-containing protein At3g... 57 5e-07 XP_004149816.1 PREDICTED: ankyrin repeat-containing protein At3g... 57 5e-07 KHN20291.1 Ankyrin repeat-containing protein [Glycine soja] 57 6e-07 KYP75419.1 Ankyrin repeat-containing protein At3g12360 family [C... 57 7e-07 GAU12137.1 hypothetical protein TSUD_01020 [Trifolium subterraneum] 57 7e-07 EEF35597.1 ankyrin repeat-containing protein, putative [Ricinus ... 57 7e-07 XP_003556545.1 PREDICTED: ankyrin repeat-containing protein At3g... 57 7e-07 XP_002526791.2 PREDICTED: ankyrin repeat-containing protein At3g... 57 7e-07 GAU12136.1 hypothetical protein TSUD_01030 [Trifolium subterraneum] 57 7e-07 XP_004497323.1 PREDICTED: ankyrin repeat-containing protein At3g... 57 7e-07 AKQ21140.1 ankyrin-repeat protein [Pisum sativum] 57 7e-07 XP_013470475.1 ankyrin repeat plant-like protein [Medicago trunc... 57 7e-07 GAV77266.1 Ank_2 domain-containing protein/Ank_3 domain-containi... 57 1e-06 XP_018825615.1 PREDICTED: ankyrin repeat-containing protein ITN1... 56 1e-06 OAY45986.1 hypothetical protein MANES_07G107600 [Manihot esculenta] 56 1e-06 >XP_010101516.1 Ankyrin repeat-containing protein [Morus notabilis] EXB88513.1 Ankyrin repeat-containing protein [Morus notabilis] Length = 584 Score = 59.7 bits (143), Expect = 8e-08 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 SMRKREK RSGSNSWHHSDFSNSE+DRIYAL Sbjct: 552 SMRKREKSAKRSGSNSWHHSDFSNSEIDRIYAL 584 >OIW06819.1 hypothetical protein TanjilG_03714 [Lupinus angustifolius] Length = 582 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 SMRKREK RSGSNSWHHSDFSNSEVDRIYA+ Sbjct: 550 SMRKREKSARRSGSNSWHHSDFSNSEVDRIYAI 582 >XP_019452558.1 PREDICTED: ankyrin repeat-containing protein ITN1-like isoform X2 [Lupinus angustifolius] Length = 598 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 SMRKREK RSGSNSWHHSDFSNSEVDRIYA+ Sbjct: 566 SMRKREKSARRSGSNSWHHSDFSNSEVDRIYAI 598 >XP_019452557.1 PREDICTED: ankyrin repeat-containing protein ITN1-like isoform X1 [Lupinus angustifolius] Length = 602 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 SMRKREK RSGSNSWHHSDFSNSEVDRIYA+ Sbjct: 570 SMRKREKSARRSGSNSWHHSDFSNSEVDRIYAI 602 >XP_018836507.1 PREDICTED: ankyrin repeat-containing protein ITN1-like [Juglans regia] Length = 588 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = -2 Query: 399 SMRKREK-LRSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHSDFSNSEVDRI+AL Sbjct: 557 SMRKKEKHARSGSNSWHHSDFSNSEVDRIFAL 588 >XP_008463527.1 PREDICTED: ankyrin repeat-containing protein At3g12360 [Cucumis melo] Length = 590 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 S+RK+EK RSGSNSWHHSDFSNSEVDRIYAL Sbjct: 558 SIRKKEKSNRRSGSNSWHHSDFSNSEVDRIYAL 590 >XP_004149816.1 PREDICTED: ankyrin repeat-containing protein At3g12360 [Cucumis sativus] KGN51258.1 hypothetical protein Csa_5G505190 [Cucumis sativus] Length = 590 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 S+RK+EK RSGSNSWHHSDFSNSEVDRIYAL Sbjct: 558 SVRKKEKSNRRSGSNSWHHSDFSNSEVDRIYAL 590 >KHN20291.1 Ankyrin repeat-containing protein [Glycine soja] Length = 320 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -2 Query: 399 SMRKREKL---RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHS+FSNSEVDRIYAL Sbjct: 287 SMRKKEKQAARRSGSNSWHHSEFSNSEVDRIYAL 320 >KYP75419.1 Ankyrin repeat-containing protein At3g12360 family [Cajanus cajan] Length = 538 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -2 Query: 399 SMRKREKL---RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHS+FSNSEVDRIYAL Sbjct: 505 SMRKKEKQLARRSGSNSWHHSEFSNSEVDRIYAL 538 >GAU12137.1 hypothetical protein TSUD_01020 [Trifolium subterraneum] Length = 570 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -2 Query: 399 SMRKREKL---RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHS+FSNSEVDRIYAL Sbjct: 537 SMRKKEKQQARRSGSNSWHHSEFSNSEVDRIYAL 570 >EEF35597.1 ankyrin repeat-containing protein, putative [Ricinus communis] Length = 570 Score = 57.0 bits (136), Expect = 7e-07 Identities = 29/33 (87%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 SMRKREK RSGSNSW HSDFSNSEVDRIYAL Sbjct: 538 SMRKREKSARRSGSNSWQHSDFSNSEVDRIYAL 570 >XP_003556545.1 PREDICTED: ankyrin repeat-containing protein At3g12360-like [Glycine max] KRG92972.1 hypothetical protein GLYMA_20G241200 [Glycine max] Length = 585 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -2 Query: 399 SMRKREKL---RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHS+FSNSEVDRIYAL Sbjct: 552 SMRKKEKQAARRSGSNSWHHSEFSNSEVDRIYAL 585 >XP_002526791.2 PREDICTED: ankyrin repeat-containing protein At3g12360 [Ricinus communis] Length = 588 Score = 57.0 bits (136), Expect = 7e-07 Identities = 29/33 (87%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 SMRKREK RSGSNSW HSDFSNSEVDRIYAL Sbjct: 556 SMRKREKSARRSGSNSWQHSDFSNSEVDRIYAL 588 >GAU12136.1 hypothetical protein TSUD_01030 [Trifolium subterraneum] Length = 591 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -2 Query: 399 SMRKREKL---RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHS+FSNSEVDRIYAL Sbjct: 558 SMRKKEKQQARRSGSNSWHHSEFSNSEVDRIYAL 591 >XP_004497323.1 PREDICTED: ankyrin repeat-containing protein At3g12360 [Cicer arietinum] Length = 591 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -2 Query: 399 SMRKREKL---RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHS+FSNSEVDRIYAL Sbjct: 558 SMRKKEKQQARRSGSNSWHHSEFSNSEVDRIYAL 591 >AKQ21140.1 ankyrin-repeat protein [Pisum sativum] Length = 592 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -2 Query: 399 SMRKREKL---RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHS+FSNSEVDRIYAL Sbjct: 559 SMRKKEKQQARRSGSNSWHHSEFSNSEVDRIYAL 592 >XP_013470475.1 ankyrin repeat plant-like protein [Medicago truncatula] KEH44513.1 ankyrin repeat plant-like protein [Medicago truncatula] Length = 593 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -2 Query: 399 SMRKREKL---RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSWHHS+FSNSEVDRIYAL Sbjct: 560 SMRKKEKQLARRSGSNSWHHSEFSNSEVDRIYAL 593 >GAV77266.1 Ank_2 domain-containing protein/Ank_3 domain-containing protein/Ank_4 domain-containing protein/PGG domain-containing protein [Cephalotus follicularis] Length = 588 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 SMRKREK RSGSNSWH SDFSNSE+DRIYAL Sbjct: 556 SMRKREKSTRRSGSNSWHQSDFSNSEIDRIYAL 588 >XP_018825615.1 PREDICTED: ankyrin repeat-containing protein ITN1-like [Juglans regia] Length = 456 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/33 (87%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREK--LRSGSNSWHHSDFSNSEVDRIYAL 307 SMRKREK RS SNSWHHSDFSNSEVDRIYAL Sbjct: 424 SMRKREKHSRRSLSNSWHHSDFSNSEVDRIYAL 456 >OAY45986.1 hypothetical protein MANES_07G107600 [Manihot esculenta] Length = 587 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -2 Query: 399 SMRKREKL--RSGSNSWHHSDFSNSEVDRIYAL 307 SMRK+EK RSGSNSW HSDFSNSEVDRIYAL Sbjct: 555 SMRKKEKYARRSGSNSWQHSDFSNSEVDRIYAL 587