BLASTX nr result
ID: Panax24_contig00028859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028859 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW06819.1 hypothetical protein TanjilG_03714 [Lupinus angustifo... 62 9e-09 XP_019452558.1 PREDICTED: ankyrin repeat-containing protein ITN1... 62 9e-09 XP_019452557.1 PREDICTED: ankyrin repeat-containing protein ITN1... 62 9e-09 XP_010101516.1 Ankyrin repeat-containing protein [Morus notabili... 61 2e-08 XP_008463527.1 PREDICTED: ankyrin repeat-containing protein At3g... 60 4e-08 XP_004149816.1 PREDICTED: ankyrin repeat-containing protein At3g... 60 4e-08 KHN20291.1 Ankyrin repeat-containing protein [Glycine soja] 60 5e-08 KYP75419.1 Ankyrin repeat-containing protein At3g12360 family [C... 60 6e-08 GAU12137.1 hypothetical protein TSUD_01020 [Trifolium subterraneum] 60 6e-08 EEF35597.1 ankyrin repeat-containing protein, putative [Ricinus ... 60 6e-08 XP_003556545.1 PREDICTED: ankyrin repeat-containing protein At3g... 60 6e-08 XP_002526791.2 PREDICTED: ankyrin repeat-containing protein At3g... 60 6e-08 GAU12136.1 hypothetical protein TSUD_01030 [Trifolium subterraneum] 60 6e-08 XP_004497323.1 PREDICTED: ankyrin repeat-containing protein At3g... 60 6e-08 AKQ21140.1 ankyrin-repeat protein [Pisum sativum] 60 6e-08 XP_013470475.1 ankyrin repeat plant-like protein [Medicago trunc... 60 6e-08 GAV77266.1 Ank_2 domain-containing protein/Ank_3 domain-containi... 59 8e-08 XP_018825615.1 PREDICTED: ankyrin repeat-containing protein ITN1... 59 1e-07 XP_018828091.1 PREDICTED: ankyrin repeat-containing protein ITN1... 59 1e-07 XP_017414869.1 PREDICTED: ankyrin repeat-containing protein At3g... 59 1e-07 >OIW06819.1 hypothetical protein TanjilG_03714 [Lupinus angustifolius] Length = 582 Score = 62.0 bits (149), Expect = 9e-09 Identities = 30/33 (90%), Positives = 31/33 (93%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK RRSGSNSWHHSDFSNSEVDRIYA+ Sbjct: 550 SMRKREKSARRSGSNSWHHSDFSNSEVDRIYAI 582 >XP_019452558.1 PREDICTED: ankyrin repeat-containing protein ITN1-like isoform X2 [Lupinus angustifolius] Length = 598 Score = 62.0 bits (149), Expect = 9e-09 Identities = 30/33 (90%), Positives = 31/33 (93%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK RRSGSNSWHHSDFSNSEVDRIYA+ Sbjct: 566 SMRKREKSARRSGSNSWHHSDFSNSEVDRIYAI 598 >XP_019452557.1 PREDICTED: ankyrin repeat-containing protein ITN1-like isoform X1 [Lupinus angustifolius] Length = 602 Score = 62.0 bits (149), Expect = 9e-09 Identities = 30/33 (90%), Positives = 31/33 (93%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK RRSGSNSWHHSDFSNSEVDRIYA+ Sbjct: 570 SMRKREKSARRSGSNSWHHSDFSNSEVDRIYAI 602 >XP_010101516.1 Ankyrin repeat-containing protein [Morus notabilis] EXB88513.1 Ankyrin repeat-containing protein [Morus notabilis] Length = 584 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK +RSGSNSWHHSDFSNSE+DRIYAL Sbjct: 552 SMRKREKSAKRSGSNSWHHSDFSNSEIDRIYAL 584 >XP_008463527.1 PREDICTED: ankyrin repeat-containing protein At3g12360 [Cucumis melo] Length = 590 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 S+RK+EK RRSGSNSWHHSDFSNSEVDRIYAL Sbjct: 558 SIRKKEKSNRRSGSNSWHHSDFSNSEVDRIYAL 590 >XP_004149816.1 PREDICTED: ankyrin repeat-containing protein At3g12360 [Cucumis sativus] KGN51258.1 hypothetical protein Csa_5G505190 [Cucumis sativus] Length = 590 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 S+RK+EK RRSGSNSWHHSDFSNSEVDRIYAL Sbjct: 558 SVRKKEKSNRRSGSNSWHHSDFSNSEVDRIYAL 590 >KHN20291.1 Ankyrin repeat-containing protein [Glycine soja] Length = 320 Score = 59.7 bits (143), Expect = 5e-08 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYAL Sbjct: 287 SMRKKEKQAARRSGSNSWHHSEFSNSEVDRIYAL 320 >KYP75419.1 Ankyrin repeat-containing protein At3g12360 family [Cajanus cajan] Length = 538 Score = 59.7 bits (143), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYAL Sbjct: 505 SMRKKEKQLARRSGSNSWHHSEFSNSEVDRIYAL 538 >GAU12137.1 hypothetical protein TSUD_01020 [Trifolium subterraneum] Length = 570 Score = 59.7 bits (143), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYAL Sbjct: 537 SMRKKEKQQARRSGSNSWHHSEFSNSEVDRIYAL 570 >EEF35597.1 ankyrin repeat-containing protein, putative [Ricinus communis] Length = 570 Score = 59.7 bits (143), Expect = 6e-08 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK RRSGSNSW HSDFSNSEVDRIYAL Sbjct: 538 SMRKREKSARRSGSNSWQHSDFSNSEVDRIYAL 570 >XP_003556545.1 PREDICTED: ankyrin repeat-containing protein At3g12360-like [Glycine max] KRG92972.1 hypothetical protein GLYMA_20G241200 [Glycine max] Length = 585 Score = 59.7 bits (143), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYAL Sbjct: 552 SMRKKEKQAARRSGSNSWHHSEFSNSEVDRIYAL 585 >XP_002526791.2 PREDICTED: ankyrin repeat-containing protein At3g12360 [Ricinus communis] Length = 588 Score = 59.7 bits (143), Expect = 6e-08 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK RRSGSNSW HSDFSNSEVDRIYAL Sbjct: 556 SMRKREKSARRSGSNSWQHSDFSNSEVDRIYAL 588 >GAU12136.1 hypothetical protein TSUD_01030 [Trifolium subterraneum] Length = 591 Score = 59.7 bits (143), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYAL Sbjct: 558 SMRKKEKQQARRSGSNSWHHSEFSNSEVDRIYAL 591 >XP_004497323.1 PREDICTED: ankyrin repeat-containing protein At3g12360 [Cicer arietinum] Length = 591 Score = 59.7 bits (143), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYAL Sbjct: 558 SMRKKEKQQARRSGSNSWHHSEFSNSEVDRIYAL 591 >AKQ21140.1 ankyrin-repeat protein [Pisum sativum] Length = 592 Score = 59.7 bits (143), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYAL Sbjct: 559 SMRKKEKQQARRSGSNSWHHSEFSNSEVDRIYAL 592 >XP_013470475.1 ankyrin repeat plant-like protein [Medicago truncatula] KEH44513.1 ankyrin repeat plant-like protein [Medicago truncatula] Length = 593 Score = 59.7 bits (143), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYAL Sbjct: 560 SMRKKEKQLARRSGSNSWHHSEFSNSEVDRIYAL 593 >GAV77266.1 Ank_2 domain-containing protein/Ank_3 domain-containing protein/Ank_4 domain-containing protein/PGG domain-containing protein [Cephalotus follicularis] Length = 588 Score = 59.3 bits (142), Expect = 8e-08 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK RRSGSNSWH SDFSNSE+DRIYAL Sbjct: 556 SMRKREKSTRRSGSNSWHQSDFSNSEIDRIYAL 588 >XP_018825615.1 PREDICTED: ankyrin repeat-containing protein ITN1-like [Juglans regia] Length = 456 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK RRS SNSWHHSDFSNSEVDRIYAL Sbjct: 424 SMRKREKHSRRSLSNSWHHSDFSNSEVDRIYAL 456 >XP_018828091.1 PREDICTED: ankyrin repeat-containing protein ITN1-like [Juglans regia] Length = 593 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 364 SMRKREK--RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRKREK RRS SNSWHHSDFSNSEVDRIYAL Sbjct: 561 SMRKREKHSRRSLSNSWHHSDFSNSEVDRIYAL 593 >XP_017414869.1 PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform X1 [Vigna angularis] Length = 598 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 3/34 (8%) Frame = -2 Query: 364 SMRKREK---RRSGSNSWHHSDFSNSEVDRIYAL 272 SMRK+EK RRSGSNSWHHS+FSNSEVDRIYA+ Sbjct: 565 SMRKKEKQLARRSGSNSWHHSEFSNSEVDRIYAI 598