BLASTX nr result
ID: Panax24_contig00028507
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028507 (561 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A05190 hypothetical protein 77 - common tobacco chloroplast... 120 2e-32 ERN02875.1 hypothetical protein AMTR_s00334p00015220 [Amborella ... 112 3e-29 OIW17041.1 hypothetical protein TanjilG_00183 [Lupinus angustifo... 108 5e-28 XP_003620942.1 photosystem I assembly protein ycf3 [Medicago tru... 108 5e-28 XP_003599571.2 photosystem I assembly protein ycf3 [Medicago tru... 105 1e-26 EPS73911.1 hypothetical protein M569_00846 [Genlisea aurea] 85 1e-17 YP_009170428.1 hypothetical chloroplast RF34 (chloroplast) [Humu... 85 2e-17 YP_009170069.1 hypothetical chloroplast RF34 (chloroplast) [Larr... 84 3e-17 XP_016652512.1 PREDICTED: photosystem I assembly protein Ycf3 [P... 84 5e-17 YP_006503792.1 photosystem I assembly protein Ycf3 (chloroplast)... 84 6e-17 YP_086967.1 photosystem I assembly protein Ycf3 [Panax ginseng] ... 83 1e-16 YP_008814857.1 hypothetical chloroplast RF21 (chloroplast) [Aral... 83 1e-16 ADK89694.1 hypothetical chloroplast RF34 (chloroplast) [Hydrocot... 83 1e-16 YP_009241053.1 photosystem I assembly protein Ycf3 (chloroplast)... 83 1e-16 AIP85231.1 Ycf3 (chloroplast) [Camellia sinensis] 81 2e-16 YP_009331698.1 Ycf3 (chloroplast) [Arracacia xanthorrhiza] AFU96... 81 2e-16 ABU85542.1 photosystem I assembly protein ycf3, partial (chlorop... 81 2e-16 XP_013443688.1 30S ribosomal protein S4, putative [Medicago trun... 86 2e-16 YP_009162878.1 photosystem I assembly protein ycf3 (chloroplast)... 81 2e-16 YP_003359360.2 photosystem I assembly protein Ycf3 (chloroplast)... 82 2e-16 >pir||A05190 hypothetical protein 77 - common tobacco chloroplast prf||1211235AD ORF 77 Length = 77 Score = 120 bits (301), Expect = 2e-32 Identities = 63/75 (84%), Positives = 66/75 (88%) Frame = -3 Query: 559 FNIITRSKRHSLFPILSGLIEPSLRYFRISLSNGLFSPVGIGESIPSLRTVLESFLPHTA 380 FNIIT SKR+SLFPILSGLIEPSL FRISL NGLFSP GIG SIPSLRTVLE+FLPHTA Sbjct: 3 FNIITGSKRYSLFPILSGLIEPSLCNFRISLLNGLFSPAGIGSSIPSLRTVLENFLPHTA 62 Query: 379 QQSILLVSPILIYHI 335 QQSILLVS +YHI Sbjct: 63 QQSILLVSHFDLYHI 77 >ERN02875.1 hypothetical protein AMTR_s00334p00015220 [Amborella trichopoda] Length = 70 Score = 112 bits (279), Expect = 3e-29 Identities = 54/58 (93%), Positives = 55/58 (94%) Frame = +2 Query: 386 MR*ETLKYGSKGRN*LAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 MR ETLKYGSKGRN AYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 1 MRSETLKYGSKGRNLSAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQALALTPGNYIE 58 >OIW17041.1 hypothetical protein TanjilG_00183 [Lupinus angustifolius] Length = 70 Score = 108 bits (271), Expect = 5e-28 Identities = 53/58 (91%), Positives = 54/58 (93%) Frame = +2 Query: 386 MR*ETLKYGSKGRN*LAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 MR ETLKYGSKGRN L YSDRGEQAIRQG SEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 1 MRQETLKYGSKGRNLLTYSDRGEQAIRQGYSEIAEAWFDQAAEYWKQAIALTPGNYIE 58 >XP_003620942.1 photosystem I assembly protein ycf3 [Medicago truncatula] AES77160.1 photosystem I assembly protein ycf3 [Medicago truncatula] Length = 70 Score = 108 bits (271), Expect = 5e-28 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = +2 Query: 395 ETLKYGSKGRN*LAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 ETLKYGSKGRN L YSDRGEQAIRQGDSEIAE+WFDQAAEYWKQA+ALTPGNYIE Sbjct: 4 ETLKYGSKGRNLLTYSDRGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIE 58 >XP_003599571.2 photosystem I assembly protein ycf3 [Medicago truncatula] AES69822.2 photosystem I assembly protein ycf3 [Medicago truncatula] Length = 70 Score = 105 bits (262), Expect = 1e-26 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +2 Query: 395 ETLKYGSKGRN*LAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 ETLKYGSKGRN L SDRGEQAIRQGDSEIAE+WFDQAAEYWKQA+ALTPGNYIE Sbjct: 4 ETLKYGSKGRNLLTNSDRGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIE 58 >EPS73911.1 hypothetical protein M569_00846 [Genlisea aurea] Length = 163 Score = 85.1 bits (209), Expect = 1e-17 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 437 YSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 YSDRGEQAIRQGDSEIAE WFDQAA+YWKQA+ALTPGNYIE Sbjct: 111 YSDRGEQAIRQGDSEIAEVWFDQAAQYWKQAIALTPGNYIE 151 >YP_009170428.1 hypothetical chloroplast RF34 (chloroplast) [Humulus lupulus] ALE29425.1 hypothetical chloroplast RF34 (chloroplast) [Humulus lupulus] Length = 169 Score = 84.7 bits (208), Expect = 2e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 431 LAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 + + DRGEQAIRQGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 115 ICHYDRGEQAIRQGDSEIAEAWFDQAAEYWKQALALTPGNYIE 157 >YP_009170069.1 hypothetical chloroplast RF34 (chloroplast) [Larrea tridentata] ALE28859.1 hypothetical chloroplast RF34 (chloroplast) [Larrea tridentata] Length = 169 Score = 84.3 bits (207), Expect = 3e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 431 LAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 + + DRGEQAIRQGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 115 ICHYDRGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIE 157 >XP_016652512.1 PREDICTED: photosystem I assembly protein Ycf3 [Prunus mume] Length = 177 Score = 84.0 bits (206), Expect = 5e-17 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +2 Query: 419 GRN*LAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 GR+ YSDRGEQA++QG SEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 119 GRDLPPYSDRGEQAVQQGYSEIAEAWFDQAAEYWKQAIALTPGNYIE 165 >YP_006503792.1 photosystem I assembly protein Ycf3 (chloroplast) [Datura stramonium] AEQ36939.1 photosystem I assembly protein Ycf3 (chloroplast) [Datura stramonium] AEQ37090.1 photosystem I assembly protein Ycf3 (chloroplast) [Datura stramonium] Length = 170 Score = 83.6 bits (205), Expect = 6e-17 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 437 YSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 YS RGEQAI+QGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 118 YSGRGEQAIQQGDSEIAEAWFDQAAEYWKQAIALTPGNYIE 158 >YP_086967.1 photosystem I assembly protein Ycf3 [Panax ginseng] YP_004935553.1 photosystem I assembly protein Ycf3 (chloroplast) [Eleutherococcus senticosus] YP_008814944.1 hypothetical chloroplast RF34 (chloroplast) [Brassaiopsis hainla] YP_008815031.1 hypothetical chloroplast RF34 (chloroplast) [Metapanax delavayi] YP_008815118.1 hypothetical chloroplast RF34 (chloroplast) [Schefflera delavayi] YP_008815205.1 hypothetical chloroplast RF34 (chloroplast) [Kalopanax septemlobus] YP_009121174.1 hypothetical chloroplast RF34 (chloroplast) [Panax notoginseng] YP_009122726.1 photosystem I assembly protein Ycf3 (chloroplast) [Dendropanax dentiger] YP_009155429.1 Ycf3 (chloroplast) [Panax quinquefolius] YP_009159539.1 Ycf3 (chloroplast) [Dendropanax morbifer] YP_009191854.1 photosystem I assembly protein ycf3 (chloroplast) [Panax japonicus] YP_009191941.1 photosystem I assembly protein ycf3 (chloroplast) [Panax vietnamensis] YP_009266519.1 Ycf3 (chloroplast) [Panax stipuleanatus] Q68S05.1 RecName: Full=Photosystem I assembly protein Ycf3 AAT98510.1 ycf3 protein (chloroplast) [Panax ginseng] AEO92620.1 photosystem I assembly protein Ycf3 (chloroplast) [Eleutherococcus senticosus] AGG39044.1 hypothetical chloroplast RF34 (chloroplast) [Brassaiopsis hainla] AGG39131.1 hypothetical chloroplast RF34 (chloroplast) [Metapanax delavayi] AGG39218.1 hypothetical chloroplast RF34 (chloroplast) [Schefflera delavayi] AGG39305.1 hypothetical chloroplast RF34 (chloroplast) [Kalopanax septemlobus] AGM15036.1 photosystem I assembly protein Ycf3 (chloroplast) [Panax ginseng] AGM15122.1 photosystem I assembly protein Ycf3 (chloroplast) [Panax ginseng] AGM15208.1 photosystem I assembly protein Ycf3 (chloroplast) [Panax ginseng] AGW31968.1 photosystem I assembly protein Ycf3 (chloroplast) [Panax ginseng] AIA24328.1 hypothetical chloroplast RF34 (chloroplast) [Panax notoginseng] AIX97890.1 Ycf3 (chloroplast) [Panax ginseng] AIX97977.1 Ycf3 (chloroplast) [Panax ginseng] AIX98060.1 Ycf3 (chloroplast) [Panax ginseng] AIX98145.1 Ycf3 (chloroplast) [Panax ginseng] AIX98230.1 Ycf3 (chloroplast) [Panax ginseng] AIX98315.1 Ycf3 (chloroplast) [Panax ginseng] AIX98400.1 Ycf3 (chloroplast) [Panax ginseng] AIX98485.1 Ycf3 (chloroplast) [Panax ginseng] AIX98570.1 Ycf3 (chloroplast) [Panax ginseng] AJC99489.1 Ycf3 (chloroplast) [Panax quinquefolius] AJC99574.1 Ycf3 (chloroplast) [Panax ginseng] AJC99659.1 Ycf3 (chloroplast) [Panax ginseng] AJK29855.1 photosystem I assembly protein Ycf3 (chloroplast) [Dendropanax dentiger] AKB99073.1 photosystem I assembly protein ycf3 (chloroplast) [Panax notoginseng] AKB99160.1 photosystem I assembly protein ycf3 (chloroplast) [Panax japonicus] AKB99247.1 photosystem I assembly protein ycf3 (chloroplast) [Panax vietnamensis] AKB99334.1 photosystem I assembly protein ycf3 (chloroplast) [Panax vietnamensis] AKG26601.1 photosystem I assembly protein Ycf3 (chloroplast) [Panax notoginseng] AKQ20729.1 Ycf3 (chloroplast) [Dendropanax morbifer] AKU70776.1 hypothetical chloroplast RF34 (chloroplast) [Panax notoginseng] AKZ29747.1 hypothetical chloroplast RF34 (chloroplast) [Panax quinquefolius] AMR97450.1 Ycf3 (chloroplast) [Panax vietnamensis] ANK78331.1 Ycf3 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78417.1 Ycf3 (chloroplast) [Panax stipuleanatus] ANS71770.1 Ycf3 (chloroplast) [Eleutherococcus sessiliflorus] ANS71857.1 Ycf3 (chloroplast) [Eleutherococcus gracilistylus] Length = 168 Score = 82.8 bits (203), Expect = 1e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 446 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 156 >YP_008814857.1 hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] AGG38957.1 hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] ANS71944.1 Ycf3 (chloroplast) [Aralia elata] Length = 168 Score = 82.8 bits (203), Expect = 1e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 446 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 156 >ADK89694.1 hypothetical chloroplast RF34 (chloroplast) [Hydrocotyle verticillata] Length = 168 Score = 82.8 bits (203), Expect = 1e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 446 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 156 >YP_009241053.1 photosystem I assembly protein Ycf3 (chloroplast) [Schefflera heptaphylla] AMK46185.1 photosystem I assembly protein Ycf3 (chloroplast) [Schefflera heptaphylla] Length = 169 Score = 82.8 bits (203), Expect = 1e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 446 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE Sbjct: 120 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 157 >AIP85231.1 Ycf3 (chloroplast) [Camellia sinensis] Length = 126 Score = 81.3 bits (199), Expect = 2e-16 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 446 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 RGEQAIRQGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 77 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIE 114 >YP_009331698.1 Ycf3 (chloroplast) [Arracacia xanthorrhiza] AFU96549.1 Ycf3, partial (chloroplast) [Schistostemon retusum] APH07266.1 Ycf3 (chloroplast) [Arracacia xanthorrhiza] Length = 126 Score = 81.3 bits (199), Expect = 2e-16 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 446 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 RGEQAIRQGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 77 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIE 114 >ABU85542.1 photosystem I assembly protein ycf3, partial (chloroplast) [Passiflora biflora] Length = 126 Score = 81.3 bits (199), Expect = 2e-16 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 446 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 RGEQAIRQGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 77 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIE 114 >XP_013443688.1 30S ribosomal protein S4, putative [Medicago truncatula] KEH17713.1 30S ribosomal protein S4, putative [Medicago truncatula] Length = 336 Score = 85.5 bits (210), Expect = 2e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 434 AYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 AYSDRGEQAI +GDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 281 AYSDRGEQAILEGDSEIAEAWFDQAAEYWKQAIALTPGNYIE 322 >YP_009162878.1 photosystem I assembly protein ycf3 (chloroplast) [Rheum palmatum] ABY79733.1 photosystem I assembly protein ycf3 (chloroplast) [Fagopyrum esculentum subsp. ancestrale] AKT93624.1 photosystem I assembly protein ycf3 (chloroplast) [Rheum palmatum] Length = 130 Score = 81.3 bits (199), Expect = 2e-16 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 446 RGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 RGEQAIRQGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 81 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIE 118 >YP_003359360.2 photosystem I assembly protein Ycf3 (chloroplast) [Olea europaea] ADA69927.2 photosystem I assembly protein Ycf3 (chloroplast) [Olea europaea] Length = 167 Score = 82.0 bits (201), Expect = 2e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = +2 Query: 425 N*LAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAMALTPGNYIE 559 N +A RGEQAIRQGDSEIAEAWFDQAAEYWKQA+ALTPGNYIE Sbjct: 111 NNMAVICRGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIE 155