BLASTX nr result
ID: Panax24_contig00028357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028357 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244735.1 PREDICTED: putative calcium-binding protein CML19... 73 3e-13 OAY50160.1 hypothetical protein MANES_05G113200 [Manihot esculenta] 68 1e-11 XP_012073527.1 PREDICTED: calcium-binding protein CML38-like [Ja... 68 2e-11 XP_010270643.1 PREDICTED: calcium-binding protein CML38-like [Ne... 63 9e-10 XP_002307832.1 hypothetical protein POPTR_0005s28110g [Populus t... 63 1e-09 GAV65795.1 EF_hand_5 domain-containing protein, partial [Cephalo... 61 4e-09 XP_011041111.1 PREDICTED: probable calcium-binding protein CML31... 60 9e-09 XP_011464987.1 PREDICTED: putative calcium-binding protein CML19... 60 1e-08 XP_018843097.1 PREDICTED: putative calcium-binding protein CML19... 59 2e-08 XP_018832962.1 PREDICTED: calcium-binding protein CML37-like [Ju... 59 5e-08 XP_015078742.1 PREDICTED: putative calcium-binding protein CML19... 57 2e-07 XP_010094482.1 Calcium-binding protein CML38 [Morus notabilis] E... 57 3e-07 XP_018443201.1 PREDICTED: calcium-binding protein CML38-like [Ra... 56 4e-07 XP_019197769.1 PREDICTED: putative calcium-binding protein CML19... 56 5e-07 XP_002300609.1 hypothetical protein POPTR_0002s00350g [Populus t... 56 5e-07 XP_009621777.1 PREDICTED: putative calcium-binding protein CML19... 56 5e-07 XP_007209656.1 hypothetical protein PRUPE_ppa012065mg [Prunus pe... 55 6e-07 XP_011034753.1 PREDICTED: putative calcium-binding protein CML19... 55 9e-07 XP_008237869.1 PREDICTED: probable calcium-binding protein CML31... 54 2e-06 XP_008233410.1 PREDICTED: probable calcium-binding protein CML31... 54 2e-06 >XP_017244735.1 PREDICTED: putative calcium-binding protein CML19 [Daucus carota subsp. sativus] KZM99286.1 hypothetical protein DCAR_013352 [Daucus carota subsp. sativus] Length = 210 Score = 72.8 bits (177), Expect = 3e-13 Identities = 38/80 (47%), Positives = 53/80 (66%), Gaps = 15/80 (18%) Frame = +3 Query: 174 SPNSAFRRLCQKLSPEKSRKNNSSISYS---------------ESQNCNEDMIQRVFNYF 308 S SAF+RLCQKLSP +S +N+S+ S S S+ +E+++QRVFNYF Sbjct: 25 SSTSAFKRLCQKLSPRQSPRNSSASSSSIKSSASPDRVINSSTSSKLYDEELVQRVFNYF 84 Query: 309 DEDEDGRISPSELQSCMKIV 368 DEDEDG+I+ +EL++CM V Sbjct: 85 DEDEDGKITAAELRTCMTAV 104 >OAY50160.1 hypothetical protein MANES_05G113200 [Manihot esculenta] Length = 191 Score = 68.2 bits (165), Expect = 1e-11 Identities = 36/77 (46%), Positives = 50/77 (64%), Gaps = 8/77 (10%) Frame = +3 Query: 156 KEDPNSSPNSAFRRLCQKLSPEKSRKNNSSISYSESQNCNEDM--------IQRVFNYFD 311 K P+SSP SA +L +KLSP +S K + S+S S S++ + +Q VFNYFD Sbjct: 5 KLSPSSSPKSALTKLRRKLSPRRSEKRSLSLSPSSSRSSSASSANATISTELQSVFNYFD 64 Query: 312 EDEDGRISPSELQSCMK 362 E+ DG+ISP ELQSC++ Sbjct: 65 ENGDGKISPHELQSCVR 81 >XP_012073527.1 PREDICTED: calcium-binding protein CML38-like [Jatropha curcas] KDP36713.1 hypothetical protein JCGZ_08004 [Jatropha curcas] Length = 193 Score = 67.8 bits (164), Expect = 2e-11 Identities = 37/64 (57%), Positives = 47/64 (73%), Gaps = 1/64 (1%) Frame = +3 Query: 174 SPNSAFRRLCQKLSPEKSRKNNSSISYSESQN-CNEDMIQRVFNYFDEDEDGRISPSELQ 350 SP SAF RL +KLS +S K + S S S + N C E +QRVFNYFDE+ DG+ISP+ELQ Sbjct: 22 SPKSAFSRLRRKLSSRRSHKPSLSPSSSTNSNSCTE--LQRVFNYFDENGDGKISPAELQ 79 Query: 351 SCMK 362 SC++ Sbjct: 80 SCVR 83 >XP_010270643.1 PREDICTED: calcium-binding protein CML38-like [Nelumbo nucifera] Length = 193 Score = 63.2 bits (152), Expect = 9e-10 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Frame = +3 Query: 168 NSSP-NSAFRRLCQKLSPEKSRKNNSSISYSESQNCNEDMIQRVFNYFDEDEDGRISPSE 344 +SSP +SAF++LC+KLSP+KS K S+ E + RVF Y DE+ DG+ISP E Sbjct: 23 SSSPKSSAFQKLCRKLSPKKSDKRTLSV---EPNAPKYGELDRVFRYLDENGDGKISPEE 79 Query: 345 LQSCMKIV 368 LQSC+++V Sbjct: 80 LQSCVRMV 87 >XP_002307832.1 hypothetical protein POPTR_0005s28110g [Populus trichocarpa] EEE94828.1 hypothetical protein POPTR_0005s28110g [Populus trichocarpa] Length = 197 Score = 62.8 bits (151), Expect = 1e-09 Identities = 38/85 (44%), Positives = 48/85 (56%), Gaps = 13/85 (15%) Frame = +3 Query: 153 IKEDPNSSPN---SAFRRLCQKLSPEKSRKNNSSISYSESQNCNE----------DMIQR 293 + P+SSP+ S RL +KLSP K NN +S N N + +QR Sbjct: 6 VSSSPSSSPSGNSSPLARLRRKLSPRKP-DNNHPVSLPAPTNVNNSTSAINVIGNNQLQR 64 Query: 294 VFNYFDEDEDGRISPSELQSCMKIV 368 VFNYFDED DGRISP+EL+SC+ V Sbjct: 65 VFNYFDEDGDGRISPAELRSCITTV 89 >GAV65795.1 EF_hand_5 domain-containing protein, partial [Cephalotus follicularis] Length = 187 Score = 61.2 bits (147), Expect = 4e-09 Identities = 36/74 (48%), Positives = 45/74 (60%), Gaps = 7/74 (9%) Frame = +3 Query: 168 NSSPNSAFRRLCQKLSPEKSRKNNSSISY-------SESQNCNEDMIQRVFNYFDEDEDG 326 NSSP S F RL +K SP K K S+S SE + + +QRVFNYFD + DG Sbjct: 9 NSSPKSTFGRLRRKRSPPKREKLPLSLSVNKDLEAASECSSSSSLELQRVFNYFDGNGDG 68 Query: 327 RISPSELQSCMKIV 368 RIS +ELQSC++ V Sbjct: 69 RISAAELQSCVRTV 82 >XP_011041111.1 PREDICTED: probable calcium-binding protein CML31 [Populus euphratica] Length = 195 Score = 60.5 bits (145), Expect = 9e-09 Identities = 36/83 (43%), Positives = 48/83 (57%), Gaps = 11/83 (13%) Frame = +3 Query: 153 IKEDPNSSPNSA-FRRLCQKLSPEKSRKNNSSISYSESQNCNE----------DMIQRVF 299 + P+ S NS+ RL +KLSP K NN +S +N N + +QRVF Sbjct: 6 VSSSPSPSGNSSPLARLRRKLSPRKP-DNNHPVSLPAPKNVNNSTSAINVIGNNQLQRVF 64 Query: 300 NYFDEDEDGRISPSELQSCMKIV 368 NYFDED DG+ISP+EL+SC+ V Sbjct: 65 NYFDEDGDGKISPAELRSCITTV 87 >XP_011464987.1 PREDICTED: putative calcium-binding protein CML19 [Fragaria vesca subsp. vesca] Length = 191 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = +3 Query: 156 KEDPNSSPNSAFRRLCQKLSPEKSRKNNSSISYSESQNCNEDMIQRVFNYFDEDEDGRIS 335 K SP S +LC+KLS K+ + ++S S +C+ ++ ++VF YFDE+ DG+IS Sbjct: 16 KAQQQHSPKSTLAKLCRKLSSRKAERR--TLSSPTSSSCSSEL-EKVFYYFDENGDGKIS 72 Query: 336 PSELQSCMKIV 368 P+ELQ+C++ V Sbjct: 73 PAELQTCVRTV 83 >XP_018843097.1 PREDICTED: putative calcium-binding protein CML19 [Juglans regia] Length = 189 Score = 59.3 bits (142), Expect = 2e-08 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = +3 Query: 174 SPNSAFRRLCQKLSPEKSRKNNSSISYSE-SQNCNEDMIQRVFNYFDEDEDGRISPSELQ 350 S S RL +KLS K+ K + S + SE S+ C+E +QRVF YFDED DG+ISP+ELQ Sbjct: 20 SSKSVLGRLRRKLSSRKTDKRSISSTDSETSKYCSE--LQRVFEYFDEDGDGKISPAELQ 77 Query: 351 SCMKIV 368 +C+ V Sbjct: 78 TCVSTV 83 >XP_018832962.1 PREDICTED: calcium-binding protein CML37-like [Juglans regia] Length = 198 Score = 58.5 bits (140), Expect = 5e-08 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 3/69 (4%) Frame = +3 Query: 171 SSPNSAFRRLCQKLSPEKSRKNNSSISYSESQNCNE---DMIQRVFNYFDEDEDGRISPS 341 +SP SA +LC+KLS KS + S+ S+S+ N+ +Q VF+Y D + DG+ISP+ Sbjct: 24 TSPKSALGKLCRKLSSRKSTEKQRSLLGSDSETTNKLICSELQTVFDYLDVNGDGKISPA 83 Query: 342 ELQSCMKIV 368 ELQ C+ V Sbjct: 84 ELQGCVTTV 92 >XP_015078742.1 PREDICTED: putative calcium-binding protein CML19 [Solanum pennellii] Length = 186 Score = 56.6 bits (135), Expect = 2e-07 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 3/70 (4%) Frame = +3 Query: 168 NSSPNSAFRRLCQKLSPEKSRK-NNSSIS--YSESQNCNEDMIQRVFNYFDEDEDGRISP 338 N+ S F +L K S +KS ++++IS + S + N D ++RVF YFDED DG++SP Sbjct: 9 NTENKSVFSKLKNKFSSKKSMAIDDTTISRIITTSSSENSDQLERVFTYFDEDGDGKVSP 68 Query: 339 SELQSCMKIV 368 +EL+ C+K V Sbjct: 69 AELRRCVKAV 78 >XP_010094482.1 Calcium-binding protein CML38 [Morus notabilis] EXB56236.1 Calcium-binding protein CML38 [Morus notabilis] Length = 194 Score = 56.6 bits (135), Expect = 3e-07 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 4/69 (5%) Frame = +3 Query: 165 PNSSPNSAFRRLCQKLSPEKSRKNNSSISYSESQNCNEDMIQR----VFNYFDEDEDGRI 332 P+S S+F RLC+KLSP+ R S+ E E Q+ VFNY DED DG+I Sbjct: 17 PSSPKKSSFARLCRKLSPKSGR--TPSLDQVEVDQVVESQQQQQLRMVFNYMDEDGDGKI 74 Query: 333 SPSELQSCM 359 SP EL+SC+ Sbjct: 75 SPVELRSCV 83 >XP_018443201.1 PREDICTED: calcium-binding protein CML38-like [Raphanus sativus] Length = 180 Score = 55.8 bits (133), Expect = 4e-07 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 4/64 (6%) Frame = +3 Query: 171 SSPNSAFRRLCQKLSPEKSRKNNSSISYSESQNC----NEDMIQRVFNYFDEDEDGRISP 338 + P S+F +LC+KLSPE+ +S+ ++NC N D I+ VF Y D ++DGRISP Sbjct: 5 AQPQSSFMKLCRKLSPERK---DSAAEKQHNKNCDHDKNRDDIEAVFAYMDANKDGRISP 61 Query: 339 SELQ 350 ELQ Sbjct: 62 HELQ 65 >XP_019197769.1 PREDICTED: putative calcium-binding protein CML19 [Ipomoea nil] Length = 217 Score = 56.2 bits (134), Expect = 5e-07 Identities = 37/99 (37%), Positives = 52/99 (52%), Gaps = 27/99 (27%) Frame = +3 Query: 153 IKEDPNSSPNS------AFRRLCQKLSPEKSRK---------NNSSISYSESQNC----- 272 +K+ P+SS +S AF R C KLS +K +K N SS S S S Sbjct: 8 LKKSPSSSSSSSSPKKSAFSRFCSKLSVKKGKKEEEEERVIKNASSSSSSSSDEAQASSS 67 Query: 273 -------NEDMIQRVFNYFDEDEDGRISPSELQSCMKIV 368 +++ ++RVF YFDED DGR+SP+ELQ ++ V Sbjct: 68 SSRKGKKSDECLERVFTYFDEDGDGRVSPAELQRGVRAV 106 >XP_002300609.1 hypothetical protein POPTR_0002s00350g [Populus trichocarpa] EEE79882.1 hypothetical protein POPTR_0002s00350g [Populus trichocarpa] Length = 192 Score = 55.8 bits (133), Expect = 5e-07 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 9/81 (11%) Frame = +3 Query: 153 IKEDPNSSP--NSAFRRLCQKLSPEKSRK-------NNSSISYSESQNCNEDMIQRVFNY 305 + P S+P +S RL +KLSP KS NNS+ + + + NE ++ VFNY Sbjct: 6 VSSPPYSTPANSSPLARLRRKLSPRKSHDKPHPTSVNNSTSALNVVDHNNE--LRGVFNY 63 Query: 306 FDEDEDGRISPSELQSCMKIV 368 FDE+ DG+ISP+ELQSC+ V Sbjct: 64 FDENGDGKISPAELQSCITSV 84 >XP_009621777.1 PREDICTED: putative calcium-binding protein CML19 [Nicotiana tomentosiformis] XP_016488219.1 PREDICTED: putative calcium-binding protein CML19 [Nicotiana tabacum] Length = 203 Score = 55.8 bits (133), Expect = 5e-07 Identities = 29/75 (38%), Positives = 42/75 (56%), Gaps = 13/75 (17%) Frame = +3 Query: 183 SAFRRLCQKLSPEK-------------SRKNNSSISYSESQNCNEDMIQRVFNYFDEDED 323 S F RL + SP+K + + S+S + N N D ++RVF YFDED D Sbjct: 15 SVFSRLRNRFSPKKPIIIKDDEVIDQTASTSTLSVSIINTSNENSDHLERVFTYFDEDGD 74 Query: 324 GRISPSELQSCMKIV 368 G++SP+ELQ C++ V Sbjct: 75 GKVSPAELQRCVRAV 89 >XP_007209656.1 hypothetical protein PRUPE_ppa012065mg [Prunus persica] ONI05304.1 hypothetical protein PRUPE_5G000600 [Prunus persica] Length = 185 Score = 55.5 bits (132), Expect = 6e-07 Identities = 29/73 (39%), Positives = 48/73 (65%), Gaps = 8/73 (10%) Frame = +3 Query: 174 SPNSAFRRLCQKLSPEKSRKNNSSI-------SYSESQNCNEDM-IQRVFNYFDEDEDGR 329 S +SA RLC+KLSP K++ + + + S + N D+ + +VF++FDE+ DG+ Sbjct: 7 SSSSALGRLCRKLSPRKTKAGHHDVEGPIENPTTCSSISSNSDLQMWKVFDFFDENGDGK 66 Query: 330 ISPSELQSCMKIV 368 ISP+ELQ+C++ V Sbjct: 67 ISPAELQTCVRSV 79 >XP_011034753.1 PREDICTED: putative calcium-binding protein CML19 [Populus euphratica] Length = 192 Score = 55.1 bits (131), Expect = 9e-07 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 9/81 (11%) Frame = +3 Query: 153 IKEDPNSSP--NSAFRRLCQKLSPEKSRK-------NNSSISYSESQNCNEDMIQRVFNY 305 + P S+P +S RL +KLSP KS NNS+ + + + NE ++RVFN Sbjct: 6 VSSPPYSTPANSSPLARLRRKLSPRKSHDKPHPTCVNNSTSALNVVDHNNE--LRRVFNC 63 Query: 306 FDEDEDGRISPSELQSCMKIV 368 FDE+ DG+ISP+ELQSC+ V Sbjct: 64 FDENGDGKISPAELQSCITSV 84 >XP_008237869.1 PREDICTED: probable calcium-binding protein CML31 [Prunus mume] Length = 185 Score = 54.3 bits (129), Expect = 2e-06 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 8/73 (10%) Frame = +3 Query: 174 SPNSAFRRLCQKLSPEKSRKNNSSI-------SYSESQNCNEDM-IQRVFNYFDEDEDGR 329 S +SA RLC+KLSP K+ + + + S + N D+ + ++F++FDE+ DG+ Sbjct: 7 SSSSALGRLCRKLSPRKTEAGHHEVGGPIENPTTCSSISSNSDLQMSKMFDFFDENGDGK 66 Query: 330 ISPSELQSCMKIV 368 ISP+ELQ+C++ V Sbjct: 67 ISPAELQTCVRSV 79 >XP_008233410.1 PREDICTED: probable calcium-binding protein CML31 [Prunus mume] Length = 185 Score = 54.3 bits (129), Expect = 2e-06 Identities = 28/73 (38%), Positives = 48/73 (65%), Gaps = 8/73 (10%) Frame = +3 Query: 174 SPNSAFRRLCQKLSPEKSRKNNSSI-------SYSESQNCNEDM-IQRVFNYFDEDEDGR 329 S +SA RLC+K+SP K++ + + + S + N D+ + +VF++FDE+ DG+ Sbjct: 7 SSSSALGRLCRKVSPRKTKAGHHDVEGPIENPTTCSSISSNSDLQMWKVFDFFDENGDGK 66 Query: 330 ISPSELQSCMKIV 368 ISP+ELQ+C++ V Sbjct: 67 ISPAELQTCVRSV 79