BLASTX nr result
ID: Panax24_contig00028260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028260 (487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO80192.1 hypothetical protein COLO4_24188 [Corchorus olitorius] 56 2e-06 >OMO80192.1 hypothetical protein COLO4_24188 [Corchorus olitorius] Length = 336 Score = 56.2 bits (134), Expect = 2e-06 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = -2 Query: 486 LWWSGTISVHVLVDQNREDYSVRTKFFRVCTHDIEKCNEDMLIPLVFLIKNLS---APKQ 316 LWWSGTISVHVLVDQNREDYS+ KF +V T ++K + VF+ + + PK Sbjct: 166 LWWSGTISVHVLVDQNREDYSM--KFKQVKTGFMKKFEGHWRVQPVFVDEKICFPFKPKT 223 Query: 315 WSRVGEKREG 286 W+ EG Sbjct: 224 WAEYCSCTEG 233