BLASTX nr result
ID: Panax24_contig00028118
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028118 (519 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM94204.1 hypothetical protein DCAR_017447 [Daucus carota subsp... 61 7e-08 XP_017248025.1 PREDICTED: uncharacterized protein LOC108219212 [... 61 8e-08 >KZM94204.1 hypothetical protein DCAR_017447 [Daucus carota subsp. sativus] Length = 402 Score = 61.2 bits (147), Expect = 7e-08 Identities = 29/60 (48%), Positives = 38/60 (63%) Frame = -1 Query: 180 KFISLEAQ*EYYRIMAKSFVKERGFKPEKQDGHLWNMIRERDWVGLAATPMPIPMGIVRE 1 +F S A+ E+ R+M KS VKERGF P +DG L NMI+ER W P +P+ I+RE Sbjct: 29 EFTSDGARTEFQRLMNKSIVKERGFLPTAEDGELLNMIQERGWESFCEAPEAVPLAIIRE 88 >XP_017248025.1 PREDICTED: uncharacterized protein LOC108219212 [Daucus carota subsp. sativus] Length = 922 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/61 (49%), Positives = 37/61 (60%) Frame = -1 Query: 183 RKFISLEAQ*EYYRIMAKSFVKERGFKPEKQDGHLWNMIRERDWVGLAATPMPIPMGIVR 4 +KF + EAQ E+ R+M KS KERGF P DG L MI+ R W L P +P+ IVR Sbjct: 692 KKFTTPEAQEEFIRLMGKSITKERGFLPSSGDGGLMLMIQARGWESLCKAPEAVPLSIVR 751 Query: 3 E 1 E Sbjct: 752 E 752