BLASTX nr result
ID: Panax24_contig00028075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028075 (426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006397732.1 hypothetical protein EUTSA_v10001419mg [Eutrema s... 55 3e-06 KZN06043.1 hypothetical protein DCAR_006880 [Daucus carota subsp... 54 7e-06 XP_017231097.1 PREDICTED: fidgetin-like protein 1 isoform X2 [Da... 54 8e-06 XP_015584451.1 PREDICTED: spastin isoform X3 [Ricinus communis] 54 8e-06 XP_017231096.1 PREDICTED: fidgetin-like protein 1 isoform X1 [Da... 54 8e-06 XP_015584450.1 PREDICTED: spastin isoform X2 [Ricinus communis] 54 8e-06 XP_002511743.1 PREDICTED: spastin isoform X1 [Ricinus communis] ... 54 8e-06 >XP_006397732.1 hypothetical protein EUTSA_v10001419mg [Eutrema salsugineum] ESQ39185.1 hypothetical protein EUTSA_v10001419mg [Eutrema salsugineum] Length = 495 Score = 55.5 bits (132), Expect = 3e-06 Identities = 28/31 (90%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 90 MDGVDGV-VSNERVAYKLKGYFDLAKEEIDK 1 MDGVDGV VSNER+AYKLKGYFDLAKEEI K Sbjct: 40 MDGVDGVPVSNERIAYKLKGYFDLAKEEIAK 70 >KZN06043.1 hypothetical protein DCAR_006880 [Daucus carota subsp. sativus] Length = 416 Score = 54.3 bits (129), Expect = 7e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 81 VDGVVSNERVAYKLKGYFDLAKEEIDK 1 +DGVVSNER AYKLKGYFDLAKEEIDK Sbjct: 1 MDGVVSNERAAYKLKGYFDLAKEEIDK 27 >XP_017231097.1 PREDICTED: fidgetin-like protein 1 isoform X2 [Daucus carota subsp. sativus] Length = 433 Score = 54.3 bits (129), Expect = 8e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 81 VDGVVSNERVAYKLKGYFDLAKEEIDK 1 +DGVVSNER AYKLKGYFDLAKEEIDK Sbjct: 34 MDGVVSNERAAYKLKGYFDLAKEEIDK 60 >XP_015584451.1 PREDICTED: spastin isoform X3 [Ricinus communis] Length = 464 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/32 (84%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = -1 Query: 93 HMDGVDGV-VSNERVAYKLKGYFDLAKEEIDK 1 +M+GVDG V+NERVAYKLKGYFDLAKEEIDK Sbjct: 31 NMEGVDGSPVTNERVAYKLKGYFDLAKEEIDK 62 >XP_017231096.1 PREDICTED: fidgetin-like protein 1 isoform X1 [Daucus carota subsp. sativus] Length = 478 Score = 54.3 bits (129), Expect = 8e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 81 VDGVVSNERVAYKLKGYFDLAKEEIDK 1 +DGVVSNER AYKLKGYFDLAKEEIDK Sbjct: 34 MDGVVSNERAAYKLKGYFDLAKEEIDK 60 >XP_015584450.1 PREDICTED: spastin isoform X2 [Ricinus communis] Length = 512 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/32 (84%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = -1 Query: 93 HMDGVDGV-VSNERVAYKLKGYFDLAKEEIDK 1 +M+GVDG V+NERVAYKLKGYFDLAKEEIDK Sbjct: 31 NMEGVDGSPVTNERVAYKLKGYFDLAKEEIDK 62 >XP_002511743.1 PREDICTED: spastin isoform X1 [Ricinus communis] EEF50412.1 Spastin, putative [Ricinus communis] Length = 518 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/32 (84%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = -1 Query: 93 HMDGVDGV-VSNERVAYKLKGYFDLAKEEIDK 1 +M+GVDG V+NERVAYKLKGYFDLAKEEIDK Sbjct: 31 NMEGVDGSPVTNERVAYKLKGYFDLAKEEIDK 62