BLASTX nr result
ID: Panax24_contig00027967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027967 (1039 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017246338.1 PREDICTED: UPF0544 protein C5orf45 homolog [Daucu... 59 6e-09 >XP_017246338.1 PREDICTED: UPF0544 protein C5orf45 homolog [Daucus carota subsp. sativus] Length = 330 Score = 59.3 bits (142), Expect(2) = 6e-09 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = +1 Query: 883 FALAFMAKDVRKFVQTFNIFRQFVKQNQSLELDQQPLDSSS--NESQAENWKKK 1038 FA +FMAKDVRK VQTFN+ RQ QNQSL+LDQ+ L S+S +++ +N KK Sbjct: 44 FAQSFMAKDVRKIVQTFNMSRQLADQNQSLQLDQETLASTSPKHDNNTDNQTKK 97 Score = 30.4 bits (67), Expect(2) = 6e-09 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 840 WNCVVCNQ*QSVLKL 884 W CVVCNQ QSVLK+ Sbjct: 29 WTCVVCNQKQSVLKV 43