BLASTX nr result
ID: Panax24_contig00027784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027784 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017225994.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 >XP_017225994.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Daucus carota subsp. sativus] Length = 772 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 ISDLYSSIGMPEEAERMRTIMKKRGVKKTAGWSTV 106 ISDLY+S+GM EEAERMR I+KK+G++K AGWS V Sbjct: 738 ISDLYNSLGMGEEAERMRMIIKKKGLRKMAGWSMV 772