BLASTX nr result
ID: Panax24_contig00027724
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027724 (691 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM84582.1 hypothetical protein DCAR_027996 [Daucus carota subsp... 59 1e-06 XP_017221916.1 PREDICTED: two-component response regulator ORR24... 59 1e-06 XP_017221915.1 PREDICTED: uncharacterized protein LOC108198653 i... 59 1e-06 >KZM84582.1 hypothetical protein DCAR_027996 [Daucus carota subsp. sativus] Length = 332 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 422 PDLQLKLSQSVGNHDERTHMKNVSAEINTMLSLSLSPYSSRQT 294 PDLQLKLSQ+VG D++ H+ + EINT LSLSLSPYSSRQT Sbjct: 288 PDLQLKLSQNVGIEDQKIHLNKIP-EINTALSLSLSPYSSRQT 329 >XP_017221916.1 PREDICTED: two-component response regulator ORR24-like isoform X2 [Daucus carota subsp. sativus] Length = 370 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 422 PDLQLKLSQSVGNHDERTHMKNVSAEINTMLSLSLSPYSSRQT 294 PDLQLKLSQ+VG D++ H+ + EINT LSLSLSPYSSRQT Sbjct: 326 PDLQLKLSQNVGIEDQKIHLNKIP-EINTALSLSLSPYSSRQT 367 >XP_017221915.1 PREDICTED: uncharacterized protein LOC108198653 isoform X1 [Daucus carota subsp. sativus] Length = 377 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 422 PDLQLKLSQSVGNHDERTHMKNVSAEINTMLSLSLSPYSSRQT 294 PDLQLKLSQ+VG D++ H+ + EINT LSLSLSPYSSRQT Sbjct: 333 PDLQLKLSQNVGIEDQKIHLNKIP-EINTALSLSLSPYSSRQT 374