BLASTX nr result
ID: Panax24_contig00027662
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027662 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244785.1 PREDICTED: vestitone reductase-like [Daucus carot... 60 7e-08 CAN76937.1 hypothetical protein VITISV_025424 [Vitis vinifera] 57 8e-07 CBI38847.3 unnamed protein product, partial [Vitis vinifera] 57 8e-07 XP_002278887.1 PREDICTED: vestitone reductase-like [Vitis vinife... 57 8e-07 XP_006345512.1 PREDICTED: vestitone reductase [Solanum tuberosum... 57 8e-07 XP_002278913.2 PREDICTED: vestitone reductase [Vitis vinifera] 57 9e-07 XP_019245024.1 PREDICTED: vestitone reductase [Nicotiana attenua... 56 2e-06 XP_011090635.1 PREDICTED: vestitone reductase-like [Sesamum indi... 56 2e-06 XP_009628902.2 PREDICTED: vestitone reductase-like [Nicotiana to... 54 3e-06 XP_015075118.1 PREDICTED: vestitone reductase isoform X2 [Solanu... 55 3e-06 XP_015075116.1 PREDICTED: vestitone reductase isoform X1 [Solanu... 55 3e-06 XP_010321489.2 PREDICTED: LOW QUALITY PROTEIN: vestitone reducta... 55 3e-06 XP_011090658.1 PREDICTED: vestitone reductase-like [Sesamum indi... 55 4e-06 XP_019229932.1 PREDICTED: vestitone reductase-like [Nicotiana at... 54 5e-06 XP_016445235.1 PREDICTED: vestitone reductase-like [Nicotiana ta... 54 5e-06 XP_009780733.1 PREDICTED: vestitone reductase-like [Nicotiana sy... 54 5e-06 NP_001312543.1 vestitone reductase-like [Nicotiana tabacum] AHK2... 54 5e-06 XP_002278819.1 PREDICTED: vestitone reductase [Vitis vinifera] 54 5e-06 CBI38845.3 unnamed protein product, partial [Vitis vinifera] 54 6e-06 >XP_017244785.1 PREDICTED: vestitone reductase-like [Daucus carota subsp. sativus] Length = 325 Score = 59.7 bits (143), Expect = 7e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+T FKYKYG+EEMYD+AI+CCKQKGLL Sbjct: 295 KKLLDTGFKYKYGLEEMYDDAIECCKQKGLL 325 >CAN76937.1 hypothetical protein VITISV_025424 [Vitis vinifera] Length = 327 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+T FKYKYG++EM+DEAIQCCK+KG L Sbjct: 297 KKLLDTGFKYKYGLDEMFDEAIQCCKEKGFL 327 >CBI38847.3 unnamed protein product, partial [Vitis vinifera] Length = 327 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+T FKYKYG++EM+DEAIQCCK+KG L Sbjct: 297 KKLLDTGFKYKYGLDEMFDEAIQCCKEKGFL 327 >XP_002278887.1 PREDICTED: vestitone reductase-like [Vitis vinifera] CBI38846.3 unnamed protein product, partial [Vitis vinifera] Length = 327 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+T FKYKYG++EM+DEAIQCCK+KG L Sbjct: 297 KKLLDTGFKYKYGLDEMFDEAIQCCKEKGFL 327 >XP_006345512.1 PREDICTED: vestitone reductase [Solanum tuberosum] XP_015163384.1 PREDICTED: vestitone reductase [Solanum tuberosum] XP_015163385.1 PREDICTED: vestitone reductase [Solanum tuberosum] Length = 331 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+T FKYKYG+EEM+D AI+CCKQKGLL Sbjct: 301 KKLLDTGFKYKYGLEEMFDGAIECCKQKGLL 331 >XP_002278913.2 PREDICTED: vestitone reductase [Vitis vinifera] Length = 356 Score = 56.6 bits (135), Expect = 9e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+T FKYKYG++EM+DEAIQCCK+KG L Sbjct: 326 KKLLDTGFKYKYGLDEMFDEAIQCCKEKGFL 356 >XP_019245024.1 PREDICTED: vestitone reductase [Nicotiana attenuata] XP_019245032.1 PREDICTED: vestitone reductase [Nicotiana attenuata] OIT07851.1 vestitone reductase [Nicotiana attenuata] Length = 331 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+T FKYKYG+EEM+D AI+CCKQKG+L Sbjct: 301 KKLLDTGFKYKYGLEEMFDGAIECCKQKGIL 331 >XP_011090635.1 PREDICTED: vestitone reductase-like [Sesamum indicum] Length = 333 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+ FKYKYG+EEM+DEAIQCC+QKG L Sbjct: 303 KKLLDAGFKYKYGLEEMFDEAIQCCRQKGFL 333 >XP_009628902.2 PREDICTED: vestitone reductase-like [Nicotiana tomentosiformis] XP_018634140.1 PREDICTED: vestitone reductase-like [Nicotiana tomentosiformis] Length = 194 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL T FKYKYG+EEM+D AI+CCKQ+G+L Sbjct: 164 KKLLETGFKYKYGLEEMFDGAIECCKQRGIL 194 >XP_015075118.1 PREDICTED: vestitone reductase isoform X2 [Solanum pennellii] Length = 311 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL++ FKYKYG+EEM+D AI+CCKQKGLL Sbjct: 281 KKLLDSGFKYKYGLEEMFDGAIECCKQKGLL 311 >XP_015075116.1 PREDICTED: vestitone reductase isoform X1 [Solanum pennellii] XP_015075117.1 PREDICTED: vestitone reductase isoform X1 [Solanum pennellii] Length = 324 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL++ FKYKYG+EEM+D AI+CCKQKGLL Sbjct: 294 KKLLDSGFKYKYGLEEMFDGAIECCKQKGLL 324 >XP_010321489.2 PREDICTED: LOW QUALITY PROTEIN: vestitone reductase [Solanum lycopersicum] Length = 327 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL++ FKYKYG+EEM+D AI+CCKQKGLL Sbjct: 297 KKLLDSGFKYKYGLEEMFDGAIECCKQKGLL 327 >XP_011090658.1 PREDICTED: vestitone reductase-like [Sesamum indicum] XP_011090666.1 PREDICTED: vestitone reductase-like [Sesamum indicum] Length = 338 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL+T F+YKYG+EEM+DEAI+CC+QKG + Sbjct: 308 KKLLDTGFRYKYGLEEMFDEAIECCRQKGFI 338 >XP_019229932.1 PREDICTED: vestitone reductase-like [Nicotiana attenuata] OIT29772.1 vestitone reductase [Nicotiana attenuata] Length = 329 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL T FKYKYG+EEM+D AI+CCKQ+G+L Sbjct: 299 KKLLETGFKYKYGLEEMFDGAIECCKQRGIL 329 >XP_016445235.1 PREDICTED: vestitone reductase-like [Nicotiana tabacum] Length = 329 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL T FKYKYG+EEM+D AI+CCKQ+G+L Sbjct: 299 KKLLETGFKYKYGLEEMFDGAIECCKQRGIL 329 >XP_009780733.1 PREDICTED: vestitone reductase-like [Nicotiana sylvestris] Length = 329 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL T FKYKYG+EEM+D AI+CCKQ+G+L Sbjct: 299 KKLLETGFKYKYGLEEMFDGAIECCKQRGIL 329 >NP_001312543.1 vestitone reductase-like [Nicotiana tabacum] AHK22739.1 dihydroflavonol-4-reductase [Nicotiana tabacum] Length = 329 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL 93 +KLL T FKYKYG+EEM+D AI+CCKQ+G+L Sbjct: 299 KKLLETGFKYKYGLEEMFDGAIECCKQRGIL 329 >XP_002278819.1 PREDICTED: vestitone reductase [Vitis vinifera] Length = 335 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL*F 99 +KLL+ FKYKYG++EM++EAIQCCK+KG L F Sbjct: 297 KKLLDAGFKYKYGVDEMFEEAIQCCKEKGFLNF 329 >CBI38845.3 unnamed protein product, partial [Vitis vinifera] Length = 665 Score = 54.3 bits (129), Expect = 6e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +1 Query: 1 EKLLNTEFKYKYGIEEMYDEAIQCCKQKGLL*F 99 +KLL+ FKYKYG++EM++EAIQCCK+KG L F Sbjct: 297 KKLLDAGFKYKYGVDEMFEEAIQCCKEKGFLNF 329