BLASTX nr result
ID: Panax24_contig00027554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027554 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM84571.1 hypothetical protein DCAR_028007 [Daucus carota subsp... 52 3e-06 KZM84573.1 hypothetical protein DCAR_028005 [Daucus carota subsp... 50 9e-06 >KZM84571.1 hypothetical protein DCAR_028007 [Daucus carota subsp. sativus] Length = 65 Score = 51.6 bits (122), Expect = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 126 RRRPISRRGQVKVGIVLGLAQILASAFSPTTRTKS 230 RRR I RRGQVK GIV+GLAQ +AS FSP RTK+ Sbjct: 22 RRRSIPRRGQVKAGIVIGLAQSVASVFSPNARTKA 56 >KZM84573.1 hypothetical protein DCAR_028005 [Daucus carota subsp. sativus] Length = 61 Score = 50.1 bits (118), Expect = 9e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +3 Query: 126 RRRPISRRGQVKVGIVLGLAQILASAFSPTTRTKS 230 RRR I +RGQVK GIVLGLAQ +AS FSP R KS Sbjct: 25 RRRSIPKRGQVKAGIVLGLAQSVASVFSPRARAKS 59