BLASTX nr result
ID: Panax24_contig00027299
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027299 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002274556.1 PREDICTED: uncharacterized protein LOC100254781 [... 71 1e-11 CAN75565.1 hypothetical protein VITISV_032583 [Vitis vinifera] 71 1e-11 XP_018841828.1 PREDICTED: uncharacterized protein LOC109006870 i... 70 2e-11 XP_012086488.1 PREDICTED: uncharacterized aarF domain-containing... 68 1e-10 XP_012086487.1 PREDICTED: uncharacterized aarF domain-containing... 68 1e-10 XP_015877148.1 PREDICTED: uncharacterized protein sll0005-like [... 68 2e-10 KCW65391.1 hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis] 68 2e-10 KCW65390.1 hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis] 68 2e-10 XP_010067294.1 PREDICTED: uncharacterized protein LOC104454207 [... 68 2e-10 XP_010099629.1 Uncharacterized protein L484_013421 [Morus notabi... 65 2e-09 XP_008446897.1 PREDICTED: uncharacterized protein slr1919 [Cucum... 65 2e-09 GAV89069.1 APH domain-containing protein/ABC1 domain-containing ... 64 3e-09 XP_011655888.1 PREDICTED: uncharacterized aarF domain-containing... 64 4e-09 KZV24276.1 hypothetical protein F511_01758 [Dorcoceras hygrometr... 64 5e-09 OAY45933.1 hypothetical protein MANES_07G104400 [Manihot esculen... 63 7e-09 OAY45936.1 hypothetical protein MANES_07G104400 [Manihot esculenta] 63 7e-09 OAY45934.1 hypothetical protein MANES_07G104400 [Manihot esculenta] 63 7e-09 XP_017235685.1 PREDICTED: uncharacterized protein sll0005 [Daucu... 63 1e-08 EEF29135.1 Ubiquinone biosynthesis protein coq-8, putative [Rici... 62 1e-08 XP_015583319.1 PREDICTED: uncharacterized protein slr1919 [Ricin... 62 1e-08 >XP_002274556.1 PREDICTED: uncharacterized protein LOC100254781 [Vitis vinifera] CBI31476.3 unnamed protein product, partial [Vitis vinifera] Length = 824 Score = 70.9 bits (172), Expect = 1e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 426 LRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 LRFCWAS MF+ ASALACHR++VSLSE+YLGPVS K+ A+ A Sbjct: 780 LRFCWASFIMFMTASALACHRILVSLSEIYLGPVSLPSKRVAISA 824 >CAN75565.1 hypothetical protein VITISV_032583 [Vitis vinifera] Length = 825 Score = 70.9 bits (172), Expect = 1e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 426 LRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 LRFCWAS MF+ ASALACHR++VSLSE+YLGPVS K+ A+ A Sbjct: 781 LRFCWASFIMFMTASALACHRILVSLSEIYLGPVSLPSKRVAISA 825 >XP_018841828.1 PREDICTED: uncharacterized protein LOC109006870 isoform X1 [Juglans regia] XP_018841831.1 PREDICTED: uncharacterized protein LOC109006873 isoform X1 [Juglans regia] XP_018806349.1 PREDICTED: uncharacterized protein LOC108979998 isoform X1 [Juglans regia] Length = 830 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 ++RFCWAS MF+ ASALACHR++VSLSE YL PVSF+ K++AV A Sbjct: 785 LMRFCWASFVMFVTASALACHRLLVSLSETYLSPVSFAPKRYAVSA 830 >XP_012086488.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic isoform X2 [Jatropha curcas] Length = 674 Score = 68.2 bits (165), Expect = 1e-10 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 IL+FCW S+ M + ASALACHRV+VSLSEVY+ P+SF++K+ A+ A Sbjct: 629 ILKFCWTSIVMIVTASALACHRVLVSLSEVYISPLSFARKRVAISA 674 >XP_012086487.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic isoform X1 [Jatropha curcas] KDP25718.1 hypothetical protein JCGZ_23939 [Jatropha curcas] Length = 838 Score = 68.2 bits (165), Expect = 1e-10 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 IL+FCW S+ M + ASALACHRV+VSLSEVY+ P+SF++K+ A+ A Sbjct: 793 ILKFCWTSIVMIVTASALACHRVLVSLSEVYISPLSFARKRVAISA 838 >XP_015877148.1 PREDICTED: uncharacterized protein sll0005-like [Ziziphus jujuba] Length = 609 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 +LRF W S MF+ SALACHRVVVSLSE YLGP+S + K++A+GA Sbjct: 564 MLRFFWVSFIMFVTTSALACHRVVVSLSEAYLGPISIAPKRYAIGA 609 >KCW65391.1 hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis] Length = 831 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAV 298 +LRFCW+S+ +F+ ASALACHR VV+LSE YLGP+SF K+FA+ Sbjct: 786 MLRFCWSSLVIFVTASALACHRAVVNLSEAYLGPLSFVPKRFAI 829 >KCW65390.1 hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis] Length = 839 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAV 298 +LRFCW+S+ +F+ ASALACHR VV+LSE YLGP+SF K+FA+ Sbjct: 794 MLRFCWSSLVIFVTASALACHRAVVNLSEAYLGPLSFVPKRFAI 837 >XP_010067294.1 PREDICTED: uncharacterized protein LOC104454207 [Eucalyptus grandis] KCW65392.1 hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis] Length = 842 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAV 298 +LRFCW+S+ +F+ ASALACHR VV+LSE YLGP+SF K+FA+ Sbjct: 797 MLRFCWSSLVIFVTASALACHRAVVNLSEAYLGPLSFVPKRFAI 840 >XP_010099629.1 Uncharacterized protein L484_013421 [Morus notabilis] EXB80095.1 Uncharacterized protein L484_013421 [Morus notabilis] Length = 829 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVG 295 +LRF W S M L ASA+ACHRVVVSLSE Y GPVS + KQ+A+G Sbjct: 784 MLRFYWVSFVMLLTASAIACHRVVVSLSEAYFGPVSLAPKQYAMG 828 >XP_008446897.1 PREDICTED: uncharacterized protein slr1919 [Cucumis melo] Length = 844 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 +L+F W S +F ASA+ACHR+VVSLSE YLGP+S S KQ+AV A Sbjct: 798 MLKFFWTSFVIFATASAMACHRIVVSLSEAYLGPISLSPKQYAVSA 843 >GAV89069.1 APH domain-containing protein/ABC1 domain-containing protein [Cephalotus follicularis] Length = 832 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVG 295 +LRFCW MF+ ASALA HR +VSLSE YLGPVS++ ++FA+G Sbjct: 787 MLRFCWTCFVMFVTASALAFHRFLVSLSETYLGPVSYASQEFAIG 831 >XP_011655888.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic [Cucumis sativus] KGN52281.1 hypothetical protein Csa_5G623450 [Cucumis sativus] Length = 842 Score = 63.9 bits (154), Expect = 4e-09 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAV 298 +L+F W S +F+ ASA+ACHR+VVSLSE YLGP+S S KQ+AV Sbjct: 796 MLKFFWTSFVIFVTASAVACHRIVVSLSEAYLGPISLSPKQYAV 839 >KZV24276.1 hypothetical protein F511_01758 [Dorcoceras hygrometricum] Length = 817 Score = 63.5 bits (153), Expect = 5e-09 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAV 298 +L+FCW+S MF ASALACHR+ VSLSE Y+GP S+ KQ A+ Sbjct: 772 VLKFCWSSFVMFFVASALACHRLFVSLSEAYMGPSSYPSKQIAM 815 >OAY45933.1 hypothetical protein MANES_07G104400 [Manihot esculenta] OAY45935.1 hypothetical protein MANES_07G104400 [Manihot esculenta] Length = 623 Score = 63.2 bits (152), Expect = 7e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 +L+FCW S M +AASALACHRV VSLSEVY+ P+ + K+ AVGA Sbjct: 578 MLKFCWTSFIMVVAASALACHRVFVSLSEVYISPLLLAPKRAAVGA 623 >OAY45936.1 hypothetical protein MANES_07G104400 [Manihot esculenta] Length = 719 Score = 63.2 bits (152), Expect = 7e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 +L+FCW S M +AASALACHRV VSLSEVY+ P+ + K+ AVGA Sbjct: 674 MLKFCWTSFIMVVAASALACHRVFVSLSEVYISPLLLAPKRAAVGA 719 >OAY45934.1 hypothetical protein MANES_07G104400 [Manihot esculenta] Length = 835 Score = 63.2 bits (152), Expect = 7e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 +L+FCW S M +AASALACHRV VSLSEVY+ P+ + K+ AVGA Sbjct: 790 MLKFCWTSFIMVVAASALACHRVFVSLSEVYISPLLLAPKRAAVGA 835 >XP_017235685.1 PREDICTED: uncharacterized protein sll0005 [Daucus carota subsp. sativus] KZN05608.1 hypothetical protein DCAR_006445 [Daucus carota subsp. sativus] Length = 849 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFA 301 +L+FCWAS M L+ASALACHR+VVSL E Y+GP+S ++Q A Sbjct: 805 MLKFCWASFIMLLSASALACHRMVVSLCESYIGPISLPRRQLA 847 >EEF29135.1 Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] Length = 791 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 +L+ CW SV M +AASALACHRV+VSLSE+Y+ P S ++K+ A+ A Sbjct: 746 MLKLCWTSVVMVVAASALACHRVLVSLSEIYIAPFSLARKEVALSA 791 >XP_015583319.1 PREDICTED: uncharacterized protein slr1919 [Ricinus communis] Length = 839 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -1 Query: 429 ILRFCWASVFMFLAASALACHRVVVSLSEVYLGPVSFSQKQFAVGA 292 +L+ CW SV M +AASALACHRV+VSLSE+Y+ P S ++K+ A+ A Sbjct: 794 MLKLCWTSVVMVVAASALACHRVLVSLSEIYIAPFSLARKEVALSA 839