BLASTX nr result
ID: Panax24_contig00027120
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027120 (903 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009337039.1 PREDICTED: scarecrow-like protein 3 [Pyrus x bret... 59 3e-06 XP_010097452.1 hypothetical protein L484_001843 [Morus notabilis... 59 4e-06 XP_008227238.1 PREDICTED: scarecrow-like protein 3 [Prunus mume] 58 6e-06 >XP_009337039.1 PREDICTED: scarecrow-like protein 3 [Pyrus x bretschneideri] Length = 474 Score = 59.3 bits (142), Expect = 3e-06 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 5/37 (13%) Frame = -2 Query: 98 MFQDDGSSSVTSSP-----MISLSPSLGSPYPWLKEL 3 MFQD+GSSS TSSP MISLSPSLGSPYPWLKEL Sbjct: 4 MFQDEGSSSATSSPLQCFSMISLSPSLGSPYPWLKEL 40 >XP_010097452.1 hypothetical protein L484_001843 [Morus notabilis] EXB68485.1 hypothetical protein L484_001843 [Morus notabilis] Length = 474 Score = 58.9 bits (141), Expect = 4e-06 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 5/37 (13%) Frame = -2 Query: 98 MFQDDGSSSVTSSP-----MISLSPSLGSPYPWLKEL 3 MFQD+GSSSVTSSP M SLSPSLGSPYPWLKEL Sbjct: 4 MFQDEGSSSVTSSPLQFFSMTSLSPSLGSPYPWLKEL 40 >XP_008227238.1 PREDICTED: scarecrow-like protein 3 [Prunus mume] Length = 474 Score = 58.2 bits (139), Expect = 6e-06 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 5/37 (13%) Frame = -2 Query: 98 MFQDDGSSSVTSSP-----MISLSPSLGSPYPWLKEL 3 MFQD+GSSS TSSP M+SLSPSLGSPYPWLKEL Sbjct: 4 MFQDEGSSSATSSPLQFFSMMSLSPSLGSPYPWLKEL 40