BLASTX nr result
ID: Panax24_contig00027031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027031 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007149604.1 hypothetical protein PHAVU_005G083600g [Phaseolus... 54 1e-06 XP_007161912.1 hypothetical protein PHAVU_001G108100g [Phaseolus... 53 2e-06 ABA39136.1 60S ribosomal protein L12, partial [Gossypium hirsutum] 50 3e-06 KHN48295.1 60S ribosomal protein L12-1 [Glycine soja] 51 5e-06 XP_007144076.1 hypothetical protein PHAVU_007G126600g [Phaseolus... 52 7e-06 KVH90446.1 Ribosomal protein L11 [Cynara cardunculus var. scolymus] 53 8e-06 O50003.1 RecName: Full=60S ribosomal protein L12 AAB97143.1 ribo... 52 9e-06 ABR25744.1 60S ribosomal protein l12, partial [Oryza sativa Indi... 50 9e-06 >XP_007149604.1 hypothetical protein PHAVU_005G083600g [Phaseolus vulgaris] ESW21598.1 hypothetical protein PHAVU_005G083600g [Phaseolus vulgaris] Length = 150 Score = 53.9 bits (128), Expect = 1e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 270 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 160 M L+ +KEILR+CVSVGC+VDG +P DLQQEISD Sbjct: 106 MAKDLSRSIKEILRTCVSVGCTVDGKDPKDLQQEISD 142 >XP_007161912.1 hypothetical protein PHAVU_001G108100g [Phaseolus vulgaris] ESW33906.1 hypothetical protein PHAVU_001G108100g [Phaseolus vulgaris] Length = 150 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 270 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 160 M L+ +KEILR+CVSVGC+VDG +P DLQQEISD Sbjct: 106 MEKDLSRSIKEILRTCVSVGCTVDGKDPKDLQQEISD 142 >ABA39136.1 60S ribosomal protein L12, partial [Gossypium hirsutum] Length = 45 Score = 50.4 bits (119), Expect = 3e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 270 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 160 M L +KEIL +CVSVGC+VDG +P DLQQEISD Sbjct: 1 MAKDLRETVKEILGTCVSVGCTVDGKDPKDLQQEISD 37 >KHN48295.1 60S ribosomal protein L12-1 [Glycine soja] Length = 100 Score = 51.2 bits (121), Expect = 5e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 270 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 160 M L+ +KEIL +CVSVGC+VDG +P DLQQEISD Sbjct: 56 MAKDLSGTIKEILGTCVSVGCTVDGKDPKDLQQEISD 92 >XP_007144076.1 hypothetical protein PHAVU_007G126600g [Phaseolus vulgaris] ESW16070.1 hypothetical protein PHAVU_007G126600g [Phaseolus vulgaris] Length = 150 Score = 52.0 bits (123), Expect = 7e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 270 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 160 M L+ +KEILR+CVSVGC+V+G +P DLQQEISD Sbjct: 106 MAKDLSRSIKEILRTCVSVGCTVNGKDPKDLQQEISD 142 >KVH90446.1 Ribosomal protein L11 [Cynara cardunculus var. scolymus] Length = 213 Score = 52.8 bits (125), Expect = 8e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 270 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISDV 157 M LT +KEIL +CVSVGC+VDG +P DLQQEI+DV Sbjct: 122 MAKELTGTVKEILGTCVSVGCTVDGKDPKDLQQEIADV 159 >O50003.1 RecName: Full=60S ribosomal protein L12 AAB97143.1 ribosomal protein L12 [Prunus armeniaca] Length = 166 Score = 52.0 bits (123), Expect = 9e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 270 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 160 M L +KEILR+CVSVGC+VDG +P DLQQEI+D Sbjct: 122 MAKELAGTVKEILRTCVSVGCTVDGKDPKDLQQEIAD 158 >ABR25744.1 60S ribosomal protein l12, partial [Oryza sativa Indica Group] Length = 64 Score = 49.7 bits (117), Expect = 9e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -3 Query: 270 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 160 M + +KEIL +CVSVGC+VDG +P DLQQEISD Sbjct: 20 MAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEISD 56