BLASTX nr result
ID: Panax24_contig00027020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00027020 (450 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM86574.1 hypothetical protein DCAR_023708 [Daucus carota subsp... 55 8e-07 XP_017218844.1 PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synth... 55 7e-06 >KZM86574.1 hypothetical protein DCAR_023708 [Daucus carota subsp. sativus] Length = 119 Score = 54.7 bits (130), Expect = 8e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -2 Query: 113 MAAATSSMVCTWFVAACMSVACEKDQHNPIM 21 MAAATSSM CTWFV AC+SV CE DQ +PI+ Sbjct: 1 MAAATSSMFCTWFVGACISVTCENDQQSPIL 31 >XP_017218844.1 PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Daucus carota subsp. sativus] Length = 552 Score = 54.7 bits (130), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -2 Query: 113 MAAATSSMVCTWFVAACMSVACEKDQHNPIM 21 MAAATSSM CTWFV AC+SV CE DQ +PI+ Sbjct: 1 MAAATSSMFCTWFVGACISVTCENDQQSPIL 31