BLASTX nr result
ID: Panax24_contig00026307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00026307 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243797.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 KZM98892.1 hypothetical protein DCAR_013746 [Daucus carota subsp... 55 2e-06 KVI02375.1 Pentatricopeptide repeat-containing protein [Cynara c... 54 5e-06 XP_017248663.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 5e-06 >XP_017243797.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Daucus carota subsp. sativus] Length = 567 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 35/38 (92%) Frame = -3 Query: 370 GEKELAVMVLKELHSRQVMSRNNLERLVLQYDLERFSV 257 GEKELA+MVL+ELH++QV+S++ +ERLV+QYDL++ V Sbjct: 530 GEKELAIMVLEELHAKQVISQSTMERLVMQYDLDKLLV 567 >KZM98892.1 hypothetical protein DCAR_013746 [Daucus carota subsp. sativus] Length = 575 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 35/38 (92%) Frame = -3 Query: 370 GEKELAVMVLKELHSRQVMSRNNLERLVLQYDLERFSV 257 GEKELA+MVL+ELH++QV+S++ +ERLV+QYDL++ V Sbjct: 538 GEKELAIMVLEELHAKQVISQSTMERLVMQYDLDKLLV 575 >KVI02375.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 559 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 367 EKELAVMVLKELHSRQVMSRNNLERLVLQYDLERFS 260 EKELA +VL+ELHSRQVM RN ++RL++QYD E F+ Sbjct: 523 EKELAALVLRELHSRQVMGRNTVDRLLMQYDFEDFA 558 >XP_017248663.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Daucus carota subsp. sativus] KZM93575.1 hypothetical protein DCAR_016820 [Daucus carota subsp. sativus] Length = 567 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 370 GEKELAVMVLKELHSRQVMSRNNLERLVLQYDLERFSV 257 GEKELAVMVLKEL+ RQV+SR+ +ERLV+QYDL + V Sbjct: 530 GEKELAVMVLKELNIRQVISRSTVERLVMQYDLVKLLV 567