BLASTX nr result
ID: Panax24_contig00026107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00026107 (482 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAD94093.1 sugar transporter like protein [Arabidopsis thaliana] 62 3e-10 XP_017236127.1 PREDICTED: plastidic glucose transporter 4-like [... 67 4e-10 KVI08868.1 General substrate transporter [Cynara cardunculus var... 65 2e-09 ONK66388.1 uncharacterized protein A4U43_C06F7320 [Asparagus off... 65 2e-09 KDO59059.1 hypothetical protein CISIN_1g0091081mg, partial [Citr... 62 3e-09 XP_013731149.1 PREDICTED: plastidic glucose transporter 4-like [... 62 3e-09 AAF74565.1 hexose transporter [Spinacia oleracea] 65 3e-09 KNA18475.1 hypothetical protein SOVF_070340 [Spinacia oleracea] 65 3e-09 XP_009401350.1 PREDICTED: plastidic glucose transporter 4 [Musa ... 64 4e-09 AAK62031.1 hexose transporter pGlT [Olea europaea] 64 6e-09 AAG00995.1 putative glucose translocator [Mesembryanthemum cryst... 64 6e-09 AAO26330.1 putative sugar transporter, partial [Brassica rapa su... 62 7e-09 AAB88879.1 putative sugar transporter [Prunus armeniaca] 64 8e-09 EYU34420.1 hypothetical protein MIMGU_mgv1a0059161mg, partial [E... 60 8e-09 XP_008244529.1 PREDICTED: plastidic glucose transporter 4 [Prunu... 64 8e-09 CDP02766.1 unnamed protein product [Coffea canephora] 64 8e-09 ABR16914.1 unknown [Picea sitchensis] 63 1e-08 XP_007215540.1 hypothetical protein PRUPE_ppa003780mg [Prunus pe... 63 1e-08 JAT45011.1 Plastidic glucose transporter 4 [Anthurium amnicola] ... 63 1e-08 OAY68632.1 Plastidic glucose transporter 4 [Ananas comosus] 63 1e-08 >BAD94093.1 sugar transporter like protein [Arabidopsis thaliana] Length = 63 Score = 62.4 bits (150), Expect = 3e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT+FGIS VYLGFA VC+LAVLYI Sbjct: 4 ISNFVIGLYFLSVVTKFGISSVYLGFAGVCVLAVLYI 40 >XP_017236127.1 PREDICTED: plastidic glucose transporter 4-like [Daucus carota subsp. sativus] XP_017236128.1 PREDICTED: plastidic glucose transporter 4-like [Daucus carota subsp. sativus] KZN07623.1 hypothetical protein DCAR_008460 [Daucus carota subsp. sativus] Length = 531 Score = 67.4 bits (163), Expect = 4e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 VSNFVI LYFLS VT+FGISKVYLGFASVCLLAVLYI Sbjct: 472 VSNFVIGLYFLSVVTKFGISKVYLGFASVCLLAVLYI 508 >KVI08868.1 General substrate transporter [Cynara cardunculus var. scolymus] Length = 534 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT FGISKVYLGFAS+CLLAV+YI Sbjct: 475 ISNFVIGLYFLSVVTNFGISKVYLGFASICLLAVMYI 511 >ONK66388.1 uncharacterized protein A4U43_C06F7320 [Asparagus officinalis] Length = 550 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT+FGISKVYLGFASVCLL VLYI Sbjct: 491 ISNFVIGLYFLSVVTKFGISKVYLGFASVCLLGVLYI 527 >KDO59059.1 hypothetical protein CISIN_1g0091081mg, partial [Citrus sinensis] KDO59060.1 hypothetical protein CISIN_1g0091081mg, partial [Citrus sinensis] KDO59061.1 hypothetical protein CISIN_1g0091081mg, partial [Citrus sinensis] KDO59062.1 hypothetical protein CISIN_1g0091081mg, partial [Citrus sinensis] KDO59063.1 hypothetical protein CISIN_1g0091081mg, partial [Citrus sinensis] Length = 128 Score = 61.6 bits (148), Expect = 3e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS V +FGIS VYLGFA+VCLLAVLYI Sbjct: 69 ISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYI 105 >XP_013731149.1 PREDICTED: plastidic glucose transporter 4-like [Brassica napus] Length = 131 Score = 61.6 bits (148), Expect = 3e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT+FGIS VYLGFA VC+LAV+YI Sbjct: 72 ISNFVIGLYFLSVVTKFGISSVYLGFAGVCVLAVMYI 108 >AAF74565.1 hexose transporter [Spinacia oleracea] Length = 551 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 109 SNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 SNFVI LYFLS VT+FGISKVYLGFASVC+LAVLYI Sbjct: 493 SNFVIGLYFLSVVTKFGISKVYLGFASVCVLAVLYI 528 >KNA18475.1 hypothetical protein SOVF_070340 [Spinacia oleracea] Length = 551 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 109 SNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 SNFVI LYFLS VT+FGISKVYLGFASVC+LAVLYI Sbjct: 493 SNFVIGLYFLSVVTKFGISKVYLGFASVCVLAVLYI 528 >XP_009401350.1 PREDICTED: plastidic glucose transporter 4 [Musa acuminata subsp. malaccensis] Length = 551 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 VSNFVI LYFLS V +FGISKVYLGFA+VCLLAVLYI Sbjct: 492 VSNFVIGLYFLSVVNKFGISKVYLGFATVCLLAVLYI 528 >AAK62031.1 hexose transporter pGlT [Olea europaea] Length = 544 Score = 63.9 bits (154), Expect = 6e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT+FGIS VYLGFASVCLLAV+YI Sbjct: 485 ISNFVIGLYFLSVVTKFGISTVYLGFASVCLLAVMYI 521 >AAG00995.1 putative glucose translocator [Mesembryanthemum crystallinum] Length = 555 Score = 63.9 bits (154), Expect = 6e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 109 SNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 SNFVI LYFLS VT+FGIS+VYLGFASVC+LAVLYI Sbjct: 497 SNFVIGLYFLSVVTKFGISRVYLGFASVCMLAVLYI 532 >AAO26330.1 putative sugar transporter, partial [Brassica rapa subsp. pekinensis] Length = 170 Score = 61.6 bits (148), Expect = 7e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT+FGIS VYLGFA VC+LAV+YI Sbjct: 112 ISNFVIGLYFLSVVTKFGISSVYLGFAGVCVLAVMYI 148 >AAB88879.1 putative sugar transporter [Prunus armeniaca] Length = 475 Score = 63.5 bits (153), Expect = 8e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT+FGIS VYLGFA VCLLAVLYI Sbjct: 416 ISNFVIGLYFLSFVTKFGISSVYLGFAGVCLLAVLYI 452 >EYU34420.1 hypothetical protein MIMGU_mgv1a0059161mg, partial [Erythranthe guttata] Length = 98 Score = 59.7 bits (143), Expect = 8e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS V +FGIS VYLGFASVCL AV+YI Sbjct: 39 ISNFVIGLYFLSVVNKFGISAVYLGFASVCLAAVVYI 75 >XP_008244529.1 PREDICTED: plastidic glucose transporter 4 [Prunus mume] Length = 549 Score = 63.5 bits (153), Expect = 8e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT+FGIS VYLGFA VCLLAVLYI Sbjct: 490 ISNFVIGLYFLSFVTKFGISSVYLGFAGVCLLAVLYI 526 >CDP02766.1 unnamed protein product [Coffea canephora] Length = 561 Score = 63.5 bits (153), Expect = 8e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS V ++GISKVYLGFAS+CLLAVLYI Sbjct: 502 ISNFVIGLYFLSFVNKYGISKVYLGFASICLLAVLYI 538 >ABR16914.1 unknown [Picea sitchensis] Length = 549 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 VSNFVI LYFLS V +FGISKVYLGFA+VCLLAV+Y+ Sbjct: 490 VSNFVIGLYFLSVVNKFGISKVYLGFATVCLLAVIYV 526 >XP_007215540.1 hypothetical protein PRUPE_ppa003780mg [Prunus persica] ONI17199.1 hypothetical protein PRUPE_3G144600 [Prunus persica] Length = 549 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 +SNFVI LYFLS VT+FGIS VYLGFA VCLLAVLY+ Sbjct: 490 ISNFVIGLYFLSFVTKFGISSVYLGFAGVCLLAVLYV 526 >JAT45011.1 Plastidic glucose transporter 4 [Anthurium amnicola] JAT67479.1 Plastidic glucose transporter 4 [Anthurium amnicola] Length = 551 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 VSNFVI LYFLS V +FGIS+VYLGFA+VCLLAVLYI Sbjct: 492 VSNFVIGLYFLSVVNKFGISRVYLGFATVCLLAVLYI 528 >OAY68632.1 Plastidic glucose transporter 4 [Ananas comosus] Length = 551 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 112 VSNFVIDLYFLSDVTEFGISKVYLGFASVCLLAVLYI 2 VSNFVI LYFLS V +FGISKVYLGFA++CLLAVLYI Sbjct: 492 VSNFVIGLYFLSVVNKFGISKVYLGFAAMCLLAVLYI 528