BLASTX nr result
ID: Panax24_contig00026101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00026101 (780 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017224579.1 PREDICTED: putative ribosome biogenesis protein s... 60 2e-07 >XP_017224579.1 PREDICTED: putative ribosome biogenesis protein slx9-like [Daucus carota subsp. sativus] KZM81468.1 hypothetical protein DCAR_029081 [Daucus carota subsp. sativus] Length = 159 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 780 STRADQKFEKKLQFYAKVRDTVASLGAQIAIGK 682 STRADQKFEKKLQFYAK+RD V+SLGAQ AIGK Sbjct: 11 STRADQKFEKKLQFYAKIRDKVSSLGAQKAIGK 43