BLASTX nr result
ID: Panax24_contig00025944
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00025944 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI09820.1 hypothetical protein Ccrd_011800, partial [Cynara car... 55 3e-06 GAV76086.1 ACT domain-containing protein [Cephalotus follicularis] 55 3e-06 XP_019419329.1 PREDICTED: ACT domain-containing protein ACR9 [Lu... 54 6e-06 XP_016194685.1 PREDICTED: ACT domain-containing protein ACR9 [Ar... 54 6e-06 XP_015963029.1 PREDICTED: ACT domain-containing protein ACR9 [Ar... 54 6e-06 XP_017616739.1 PREDICTED: ACT domain-containing protein ACR9-lik... 54 6e-06 XP_016665559.1 PREDICTED: ACT domain-containing protein ACR9-lik... 54 6e-06 XP_012462421.1 PREDICTED: ACT domain-containing protein ACR9-lik... 54 6e-06 OMO96939.1 hypothetical protein COLO4_14976 [Corchorus olitorius] 54 8e-06 XP_007009386.2 PREDICTED: ACT domain-containing protein ACR9 [Th... 54 8e-06 >KVI09820.1 hypothetical protein Ccrd_011800, partial [Cynara cardunculus var. scolymus] Length = 454 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLD+S FPLTSNRAK +IVD+VRR LMGW Sbjct: 423 RFLLDESRGFPLTSNRAKRDIVDKVRRTLMGW 454 >GAV76086.1 ACT domain-containing protein [Cephalotus follicularis] Length = 461 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLDDSLEFPL S A+S+IV+RVRR LMGW Sbjct: 430 RFLLDDSLEFPLASKLARSQIVERVRRTLMGW 461 >XP_019419329.1 PREDICTED: ACT domain-containing protein ACR9 [Lupinus angustifolius] OIW17274.1 hypothetical protein TanjilG_22386 [Lupinus angustifolius] Length = 420 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLD+S +FPLTS++A+S+IVD+VRR LMGW Sbjct: 389 RFLLDESRDFPLTSSKARSQIVDKVRRTLMGW 420 >XP_016194685.1 PREDICTED: ACT domain-containing protein ACR9 [Arachis ipaensis] Length = 420 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLD+S +FPLTS++A+S+IVD+VRR LMGW Sbjct: 389 RFLLDESRDFPLTSSKARSQIVDKVRRTLMGW 420 >XP_015963029.1 PREDICTED: ACT domain-containing protein ACR9 [Arachis duranensis] Length = 420 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLD+S +FPLTS++A+S+IVD+VRR LMGW Sbjct: 389 RFLLDESRDFPLTSSKARSQIVDKVRRTLMGW 420 >XP_017616739.1 PREDICTED: ACT domain-containing protein ACR9-like [Gossypium arboreum] KHG23446.1 [Protein-PII] uridylyltransferase [Gossypium arboreum] Length = 426 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLDDS EFPLTS RA++++VD+VRR LMGW Sbjct: 395 RFLLDDSHEFPLTSCRARNQLVDKVRRTLMGW 426 >XP_016665559.1 PREDICTED: ACT domain-containing protein ACR9-like [Gossypium hirsutum] Length = 427 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLDDS EFPLTS RA++++VD+VRR LMGW Sbjct: 396 RFLLDDSHEFPLTSCRARNQLVDKVRRTLMGW 427 >XP_012462421.1 PREDICTED: ACT domain-containing protein ACR9-like [Gossypium raimondii] KJB78846.1 hypothetical protein B456_013G022700 [Gossypium raimondii] Length = 427 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLDDS EFPLTS RA++++VD+VRR LMGW Sbjct: 396 RFLLDDSHEFPLTSCRARNQLVDKVRRTLMGW 427 >OMO96939.1 hypothetical protein COLO4_14976 [Corchorus olitorius] Length = 420 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLDDS EFPL S+RA+S+IVDRVR LMGW Sbjct: 389 RFLLDDSHEFPLASSRARSKIVDRVRSILMGW 420 >XP_007009386.2 PREDICTED: ACT domain-containing protein ACR9 [Theobroma cacao] Length = 429 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 3 RFLLDDSLEFPLTSNRAKSEIVDRVRRALMGW 98 RFLLDDS EFPL S++A++ IVDRVRR LMGW Sbjct: 398 RFLLDDSCEFPLASSQARNRIVDRVRRILMGW 429