BLASTX nr result
ID: Panax24_contig00025905
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00025905 (597 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KFK32428.1 hypothetical protein AALP_AA6G240600 [Arabis alpina] 52 5e-06 >KFK32428.1 hypothetical protein AALP_AA6G240600 [Arabis alpina] Length = 38 Score = 51.6 bits (122), Expect = 5e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +2 Query: 275 FFHSFPFRISRGLPNFTDGMDESFASSKCVKDPSRT 382 FF PFRISRGL N T +DESF+S KCVKD SRT Sbjct: 3 FFPFIPFRISRGLTNSTADLDESFSSYKCVKDASRT 38