BLASTX nr result
ID: Panax24_contig00025579
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00025579 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012088362.1 PREDICTED: E3 ubiquitin-protein ligase RING1 [Jat... 54 3e-06 GAV61054.1 Mpv17_PMP22 domain-containing protein/PORR domain-con... 54 7e-06 >XP_012088362.1 PREDICTED: E3 ubiquitin-protein ligase RING1 [Jatropha curcas] KDP24198.1 hypothetical protein JCGZ_25855 [Jatropha curcas] Length = 259 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 1 IVPWVKCHGQCPVCRFAICDRIRAG 75 IVPWVK HGQCPVCRFAICDRI G Sbjct: 204 IVPWVKSHGQCPVCRFAICDRIGGG 228 >GAV61054.1 Mpv17_PMP22 domain-containing protein/PORR domain-containing protein/zf-RING_2 domain-containing protein [Cephalotus follicularis] Length = 517 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/62 (40%), Positives = 29/62 (46%) Frame = +1 Query: 1 IVPWVKCHGQCPVCRFAICDRIRAGXXXXXXXXXXXXXXXDPIAGELXXXXXXXXXXXXW 180 IVPWVK HGQCPVCRFA+C+R+R + I GEL W Sbjct: 453 IVPWVKSHGQCPVCRFALCERLRESVATLNNNNFADVEANNVITGELISIIRAMEEAAIW 512 Query: 181 RN 186 N Sbjct: 513 GN 514