BLASTX nr result
ID: Panax24_contig00025130
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00025130 (619 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM97408.1 hypothetical protein DCAR_015230 [Daucus carota subsp... 68 9e-10 XP_017247703.1 PREDICTED: sulfate transporter 4.1, chloroplastic... 68 9e-10 >KZM97408.1 hypothetical protein DCAR_015230 [Daucus carota subsp. sativus] Length = 661 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = -3 Query: 617 KTPEMALNYKPNIFQRVLKQRTEDFTSTAMESGDRHFFPSKVTDPNLEPLL 465 K+PE+ +Y+PN+FQRVLK R EDFT++ +ESG +H SK T+PNLEPLL Sbjct: 606 KSPELESDYRPNLFQRVLKPRAEDFTTSELESGYKHVPISKETNPNLEPLL 656 >XP_017247703.1 PREDICTED: sulfate transporter 4.1, chloroplastic-like isoform X1 [Daucus carota subsp. sativus] Length = 694 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = -3 Query: 617 KTPEMALNYKPNIFQRVLKQRTEDFTSTAMESGDRHFFPSKVTDPNLEPLL 465 K+PE+ +Y+PN+FQRVLK R EDFT++ +ESG +H SK T+PNLEPLL Sbjct: 639 KSPELESDYRPNLFQRVLKPRAEDFTTSELESGYKHVPISKETNPNLEPLL 689