BLASTX nr result
ID: Panax24_contig00025086
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00025086 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008237721.1 PREDICTED: uncharacterized protein LOC103336456 [... 53 4e-06 >XP_008237721.1 PREDICTED: uncharacterized protein LOC103336456 [Prunus mume] Length = 741 Score = 52.8 bits (125), Expect(2) = 4e-06 Identities = 24/41 (58%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +2 Query: 218 GMFRTVLICFERFAYHRPDISHKQFGLKE--SCLHRPLVEL 334 GM RT+L+C+E+ YHRPD+S KQFG++E + + RPLVEL Sbjct: 311 GMSRTILLCYEKAVYHRPDLSPKQFGIQEVNTNMLRPLVEL 351 Score = 25.0 bits (53), Expect(2) = 4e-06 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 136 IVWQPYKRFTKD*GFLTNSC 195 IVWQPYKR D FL C Sbjct: 287 IVWQPYKRLPCD--FLPQYC 304