BLASTX nr result
ID: Panax24_contig00025036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00025036 (461 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAD22368.1 putative non-LTR retroelement reverse transcriptase [... 55 7e-06 >AAD22368.1 putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 321 Score = 54.7 bits (130), Expect = 7e-06 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = +1 Query: 319 DSWVKINSDCASRGNRGWQAAGGLISNEGGAWLG*RGFIKFLGWCSA 459 D WVK+N+D ASRGN G+ AGG++ + GAW+G GF +G CSA Sbjct: 158 DGWVKLNTDGASRGNPGFATAGGVLRDHNGAWIG--GFAVNIGVCSA 202