BLASTX nr result
ID: Panax24_contig00024950
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00024950 (385 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001238194.1 uncharacterized protein LOC100306140 [Glycine max... 205 2e-65 AEK71887.1 ribosomal protein S7, partial (plastid) [Pinzona cori... 198 2e-63 AEK78139.1 ribosomal protein S7, partial (plastid) [Austrobailey... 198 2e-63 ACV71759.1 ribosomal protein S7, partial (chloroplast) [Eccremis... 198 3e-63 ABQ14870.1 ribosomal protein S7, partial (chloroplast) [Liquidam... 198 3e-63 YP_009261526.1 ribosomal protein S7 (chloroplast) [Liriodendron ... 198 5e-63 ABQ14852.1 ribosomal protein S7 (chloroplast) [Itea virginica] 198 5e-63 YP_087012.1 ribosomal protein S7 [Panax ginseng] YP_087025.1 rib... 198 5e-63 Q67IC5.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 198 5e-63 YP_009109042.1 ribosomal protein S7 (plastid) [Corallorhiza macr... 198 5e-63 Q67IP2.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 198 5e-63 Q6EMB0.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 198 5e-63 Q6EMA4.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 198 5e-63 Q6EM62.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 198 5e-63 Q6EM87.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 198 5e-63 Q9GFN2.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 198 5e-63 YP_740248.1 ribosomal protein S7 [Liriodendron tulipifera] YP_74... 198 5e-63 YP_009180153.1 ribosomal protein S7 (chloroplast) [Polygonatum c... 198 5e-63 YP_009164362.1 ribosomal protein S7 (chloroplast) [Bupleurum fal... 198 5e-63 AIW51379.1 ribosomal protein S7 (plastid) [Corallorhiza maculata... 198 5e-63 >NP_001238194.1 uncharacterized protein LOC100306140 [Glycine max] ACU14175.1 unknown [Glycine max] Length = 173 Score = 205 bits (521), Expect = 2e-65 Identities = 104/106 (98%), Positives = 106/106 (100%) Frame = -2 Query: 318 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTET 139 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTET Sbjct: 15 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTET 74 Query: 138 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVP+EIGSTQGKALAIR Sbjct: 75 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPVEIGSTQGKALAIR 120 >AEK71887.1 ribosomal protein S7, partial (plastid) [Pinzona coriacea] Length = 130 Score = 198 bits (503), Expect = 2e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >AEK78139.1 ribosomal protein S7, partial (plastid) [Austrobaileya scandens] Length = 134 Score = 198 bits (503), Expect = 2e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >ACV71759.1 ribosomal protein S7, partial (chloroplast) [Eccremis coarctata] Length = 137 Score = 198 bits (503), Expect = 3e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >ABQ14870.1 ribosomal protein S7, partial (chloroplast) [Liquidambar styraciflua] Length = 140 Score = 198 bits (503), Expect = 3e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >YP_009261526.1 ribosomal protein S7 (chloroplast) [Liriodendron chinense] YP_009261539.1 ribosomal protein S7 (chloroplast) [Liriodendron chinense] ANN44776.1 ribosomal protein S7 (chloroplast) [Liriodendron chinense] ANN44789.1 ribosomal protein S7 (chloroplast) [Liriodendron chinense] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >ABQ14852.1 ribosomal protein S7 (chloroplast) [Itea virginica] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >YP_087012.1 ribosomal protein S7 [Panax ginseng] YP_087025.1 ribosomal protein S7 [Panax ginseng] YP_740163.1 ribosomal protein S7 (chloroplast) [Daucus carota] YP_740176.1 ribosomal protein S7 (chloroplast) [Daucus carota] YP_004222692.1 ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] YP_004222705.1 ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] YP_004935599.1 ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] YP_004935612.1 ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] YP_008815077.1 ribosomal protein S7 (chloroplast) [Metapanax delavayi] YP_008815090.1 ribosomal protein S7 (chloroplast) [Metapanax delavayi] YP_008815164.1 ribosomal protein S7 (chloroplast) [Schefflera delavayi] YP_008815177.1 ribosomal protein S7 (chloroplast) [Schefflera delavayi] YP_008814903.1 ribosomal protein S7 (chloroplast) [Aralia undulata] YP_008814916.1 ribosomal protein S7 (chloroplast) [Aralia undulata] YP_008815251.1 ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] YP_008815264.1 ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] YP_009121220.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] YP_009121233.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] YP_009122772.1 ribosomal protein S7 (chloroplast) [Dendropanax dentiger] YP_009122785.1 ribosomal protein S7 (chloroplast) [Dendropanax dentiger] YP_009155258.1 ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] YP_009155271.1 ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] YP_009155473.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] YP_009155487.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] YP_009159584.1 ribosomal protein S7 (chloroplast) [Dendropanax morbifer] YP_009159598.1 ribosomal protein S7 (chloroplast) [Dendropanax morbifer] YP_009161726.1 ribosomal protein S7 (chloroplast) [Fatsia japonica] YP_009161739.1 ribosomal protein S7 (chloroplast) [Fatsia japonica] YP_009186298.1 ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] YP_009186313.1 ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] YP_009191899.1 ribosomal protein S7 (chloroplast) [Panax japonicus] YP_009191913.1 ribosomal protein S7 (chloroplast) [Panax japonicus] YP_009191986.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] YP_009192000.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] YP_009232790.1 ribosomal protein S7 (chloroplast) [Angelica acutiloba] YP_009232806.1 ribosomal protein S7 (chloroplast) [Angelica acutiloba] YP_009232875.1 ribosomal protein S7 (chloroplast) [Angelica dahurica] YP_009232891.1 ribosomal protein S7 (chloroplast) [Angelica dahurica] YP_009232960.1 ribosomal protein S7 (chloroplast) [Angelica gigas] YP_009232976.1 ribosomal protein S7 (chloroplast) [Angelica gigas] YP_009233044.1 ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] YP_009233060.1 ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] YP_009235925.1 ribosomal protein S7 (chloroplast) [Foeniculum vulgare] YP_009235939.1 ribosomal protein S7 (chloroplast) [Foeniculum vulgare] YP_009236010.1 ribosomal protein S7 (chloroplast) [Anethum graveolens] YP_009236023.1 ribosomal protein S7 (chloroplast) [Anethum graveolens] YP_009240841.1 ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] YP_009240854.1 ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] YP_009241112.1 ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] YP_009241098.1 ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] YP_009266564.1 ribosomal protein S7 (chloroplast) [Panax stipuleanatus] YP_009266578.1 ribosomal protein S7 (chloroplast) [Panax stipuleanatus] YP_009306821.1 ribosomal protein S7 (chloroplast) [Davidia involucrata] YP_009306834.1 ribosomal protein S7 (chloroplast) [Davidia involucrata] YP_009330735.1 30S ribosomal protein S7 (chloroplast) [Viburnum utile] YP_009330748.1 30S ribosomal protein S7 (chloroplast) [Viburnum utile] YP_009331749.1 ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] YP_009338302.1 ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] YP_009338315.1 ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] YP_009338386.1 ribosomal protein S7 (chloroplast) [Peucedanum insolens] YP_009338400.1 ribosomal protein S7 (chloroplast) [Peucedanum insolens] YP_009338469.1 ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] YP_009338482.1 ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] Q68RU7.1 RecName: Full=30S ribosomal protein S7, chloroplastic Q0G9Q3.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAT98555.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AAT98570.1 ribosomal protein S7 (chloroplast) [Panax ginseng] ABI32469.1 ribosomal protein S7 (chloroplast) [Daucus carota] ABI32484.1 ribosomal protein S7 (chloroplast) [Daucus carota] ABU85171.1 ribosomal protein S7, partial (chloroplast) [Anethum graveolens] ADD13684.1 ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ADD13698.1 ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ADD29890.1 ribosomal protein S7 (chloroplast) [Aucuba japonica] ADK89824.1 ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] ADK89838.1 ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] ADK89997.1 ribosomal protein S7 (chloroplast) [Petroselinum crispum] ADK90011.1 ribosomal protein S7 (chloroplast) [Petroselinum crispum] ADM92747.1 ribosomal protein S7, partial (chloroplast) [Davidia involucrata] AEK71711.1 ribosomal protein S7 (plastid) [Aucuba japonica] AEO92665.1 ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] AEO92678.1 ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] AGG39002.1 ribosomal protein S7 (chloroplast) [Aralia undulata] AGG39017.1 ribosomal protein S7 (chloroplast) [Aralia undulata] AGG39176.1 ribosomal protein S7 (chloroplast) [Metapanax delavayi] AGG39191.1 ribosomal protein S7 (chloroplast) [Metapanax delavayi] AGG39263.1 ribosomal protein S7 (chloroplast) [Schefflera delavayi] AGG39278.1 ribosomal protein S7 (chloroplast) [Schefflera delavayi] AGG39350.1 ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] AGG39365.1 ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] AGM15028.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15029.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15114.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15115.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15200.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGM15201.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGW31960.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AGW31961.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AHJ81010.1 ribosomal protein S7 (mitochondrion) [Panax ginseng] AIA24374.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AIA24387.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AIU99067.1 ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] AIU99080.1 ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] AIX97934.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX97948.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98019.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98033.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98104.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98118.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98189.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98203.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98274.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98288.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98359.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98373.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98444.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98458.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98529.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98543.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98615.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AIX98629.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJC99533.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] AJC99547.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] AJC99618.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJC99632.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJC99703.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJC99717.1 ribosomal protein S7 (chloroplast) [Panax ginseng] AJK29888.1 ribosomal protein S7 (chloroplast) [Dendropanax dentiger] AJK29889.1 ribosomal protein S7 (chloroplast) [Dendropanax dentiger] AJO25247.1 ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] AJO25248.1 ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] AKB99118.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKB99132.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKB99205.1 ribosomal protein S7 (chloroplast) [Panax japonicus] AKB99219.1 ribosomal protein S7 (chloroplast) [Panax japonicus] AKB99292.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AKB99306.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AKB99379.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AKB99393.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AKG26647.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKG26660.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKQ20774.1 ribosomal protein S7 (chloroplast) [Dendropanax morbifer] AKQ20788.1 ribosomal protein S7 (chloroplast) [Dendropanax morbifer] AKS11000.1 ribosomal protein S7 (chloroplast) [Fatsia japonica] AKS11014.1 ribosomal protein S7 (chloroplast) [Fatsia japonica] AKU70823.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKU70837.1 ribosomal protein S7 (chloroplast) [Panax notoginseng] AKZ24089.1 ribosomal protein S7 (plastid) [Cicuta maculata] AKZ24090.1 ribosomal protein S7 (plastid) [Conium maculatum] AKZ24091.1 ribosomal protein S7 (plastid) [Zizia aurea] AKZ29807.1 ribosomal protein S7 (chloroplast) [Panax quinquefolius] ALN96875.1 ribosomal protein S7 (chloroplast) [Angelica decursiva] ALN96876.1 ribosomal protein S7 (chloroplast) [Angelica decursiva] ALO71652.1 ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] ALO71653.1 ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] AMA97862.1 ribosomal protein S7 (chloroplast) [Angelica acutiloba] AMA97863.1 ribosomal protein S7 (chloroplast) [Angelica acutiloba] AMA97948.1 ribosomal protein S7 (chloroplast) [Angelica dahurica] AMA97949.1 ribosomal protein S7 (chloroplast) [Angelica dahurica] AMA98033.1 ribosomal protein S7 (chloroplast) [Angelica gigas] AMA98034.1 ribosomal protein S7 (chloroplast) [Angelica gigas] AMA98120.1 ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] AMA98121.1 ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] AMD83961.1 ribosomal protein S7 (chloroplast) [Foeniculum vulgare] AMD83976.1 ribosomal protein S7 (chloroplast) [Foeniculum vulgare] AMD84046.1 ribosomal protein S7 (chloroplast) [Anethum graveolens] AMD84060.1 ribosomal protein S7 (chloroplast) [Anethum graveolens] AMK46209.1 ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] AMK46222.1 ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] AMR97494.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] AMR97508.1 ribosomal protein S7 (chloroplast) [Panax vietnamensis] KZM81269.1 ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] KZM81282.1 ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] ANK36397.1 ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ANK36410.1 ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ANK36481.1 ribosomal protein S7 (chloroplast) [Peucedanum insolens] ANK36495.1 ribosomal protein S7 (chloroplast) [Peucedanum insolens] ANK36564.1 ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ANK36577.1 ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ANK78376.1 ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78390.1 ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78462.1 ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ANK78476.1 ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ANS71815.1 ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] ANS71829.1 ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] ANS71902.1 ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] ANS71916.1 ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] ANS71989.1 ribosomal protein S7 (chloroplast) [Aralia elata] ANS72003.1 ribosomal protein S7 (chloroplast) [Aralia elata] ANS72075.1 ribosomal protein S7 (chloroplast) [Glehnia littoralis] ANS72091.1 ribosomal protein S7 (chloroplast) [Glehnia littoralis] ANS72158.1 ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] ANS72174.1 ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] AOQ76964.1 ribosomal protein S7 (chloroplast) [Davidia involucrata] AOQ76966.1 ribosomal protein S7 (chloroplast) [Davidia involucrata] APD79337.1 30S ribosomal protein S7 (chloroplast) [Viburnum utile] APD79350.1 30S ribosomal protein S7 (chloroplast) [Viburnum utile] APH07318.1 ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >Q67IC5.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAN32069.1 ribosomal protein S7 (chloroplast) [Xeronema callistemon] AAN32078.1 ribosomal protein S7 (chloroplast) [Asparagus officinalis] AEX94151.1 ribosomal protein S7 (chloroplast) [Asparagus officinalis] AEX94152.1 ribosomal protein S7 (chloroplast) [Asparagus asparagoides] AEX94153.1 ribosomal protein S7 (chloroplast) [Hemiphylacus alatostylus] AEX94183.1 ribosomal protein S7 (chloroplast) [Xeronema callistemon] AFG25680.1 ribosomal protein S7, partial (plastid) [Asparagus officinalis] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >YP_009109042.1 ribosomal protein S7 (plastid) [Corallorhiza macrantha] YP_009109048.1 ribosomal protein S7 (plastid) [Corallorhiza macrantha] YP_009109103.1 ribosomal protein S7 (plastid) [Corallorhiza mertensiana] YP_009109108.1 ribosomal protein S7 (plastid) [Corallorhiza mertensiana] YP_009129404.1 ribosomal protein S7 (chloroplast) [Cypripedium formosanum] YP_009129390.1 ribosomal protein S7 (chloroplast) [Cypripedium formosanum] YP_009129906.1 ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] YP_009129897.1 ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] YP_009144820.1 ribosomal protein S7 (chloroplast) [Elleanthus sodiroi] YP_009144833.1 ribosomal protein S7 (chloroplast) [Elleanthus sodiroi] YP_009143935.1 ribosomal protein S7 (plastid) [Cypripedium japonicum] YP_009143948.1 ribosomal protein S7 (plastid) [Cypripedium japonicum] YP_009176554.1 ribosomal protein S7 (chloroplast) [Sobralia aff. bouchei HTK-2015] YP_009176567.1 ribosomal protein S7 (chloroplast) [Sobralia aff. bouchei HTK-2015] YP_009175159.1 ribosomal protein S7 (chloroplast) [Sobralia callosa] YP_009175172.1 ribosomal protein S7 (chloroplast) [Sobralia callosa] YP_009179996.1 30S ribosomal protein S7 (chloroplast) [Bletilla striata] YP_009180005.1 30S ribosomal protein S7 (chloroplast) [Bletilla striata] YP_009236246.1 30S ribosomal protein S7 (chloroplast) [Bletilla ochracea] YP_009236255.1 30S ribosomal protein S7 (chloroplast) [Bletilla ochracea] YP_009269607.1 ribosomal protein S7 (chloroplast) [Cephalanthera longifolia] YP_009269620.1 ribosomal protein S7 (chloroplast) [Cephalanthera longifolia] YP_009270091.1 ribosomal protein S7 (chloroplast) [Listera fugongensis] YP_009270104.1 ribosomal protein S7 (chloroplast) [Listera fugongensis] YP_009269694.1 ribosomal protein S7 (chloroplast) [Epipactis mairei] YP_009269705.1 ribosomal protein S7 (chloroplast) [Epipactis mairei] YP_009269772.1 ribosomal protein S7 (plastid) [Cephalanthera humilis] YP_009269780.1 ribosomal protein S7 (plastid) [Cephalanthera humilis] YP_009269890.1 ribosomal protein S7 (chloroplast) [Epipactis veratrifolia] YP_009269903.1 ribosomal protein S7 (chloroplast) [Epipactis veratrifolia] YP_009270005.1 ribosomal protein S7 (chloroplast) [Neottia pinetorum] YP_009270018.1 ribosomal protein S7 (chloroplast) [Neottia pinetorum] YP_009270178.1 ribosomal protein S7 (chloroplast) [Neottia ovata] YP_009270191.1 ribosomal protein S7 (chloroplast) [Neottia ovata] YP_009270222.1 ribosomal protein S7 (plastid) [Neottia listeroides] YP_009270226.1 ribosomal protein S7 (plastid) [Neottia listeroides] YP_009270602.1 ribosomal protein S7 (chloroplast) [Apostasia odorata] YP_009270589.1 ribosomal protein S7 (chloroplast) [Apostasia odorata] Q67IG9.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAN32034.1 ribosomal protein S7 (chloroplast) [Coelogyne cristata] AAN32043.1 ribosomal protein S7 (chloroplast) [Cypripedium passerinum] AAN32057.1 ribosomal protein S7 (chloroplast) [Galearis rotundifolia] AFG25679.1 ribosomal protein S7, partial (plastid) [Apostasia wallichii] AHZ43012.1 ribosomal protein S7 (chloroplast) [Cypripedium formosanum] AHZ43013.1 ribosomal protein S7 (chloroplast) [Cypripedium formosanum] AIC37322.1 ribosomal protein S7 (plastid) [Cypripedium japonicum] AIC37334.1 ribosomal protein S7 (plastid) [Cypripedium japonicum] AID52286.1 ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] AID52287.1 ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] AIS67418.1 ribosomal protein S7 (chloroplast) [Sobralia callosa] AIS67431.1 ribosomal protein S7 (chloroplast) [Sobralia callosa] AIW51306.1 ribosomal protein S7 (plastid) [Corallorhiza maculata var. maculata] AIW51313.1 ribosomal protein S7 (plastid) [Corallorhiza maculata var. maculata] AIW51438.1 ribosomal protein S7 (plastid) [Corallorhiza maculata var. occidentalis] AIW51446.1 ribosomal protein S7 (plastid) [Corallorhiza maculata var. occidentalis] AIW51510.1 ribosomal protein S7 (plastid) [Corallorhiza macrantha] AIW51518.1 ribosomal protein S7 (plastid) [Corallorhiza macrantha] AIW51571.1 ribosomal protein S7 (plastid) [Corallorhiza mertensiana] AIW51578.1 ribosomal protein S7 (plastid) [Corallorhiza mertensiana] AIY56228.1 ribosomal protein S7 (chloroplast) [Neuwiedia zollingeri var. singapureana] AIY56229.1 ribosomal protein S7 (chloroplast) [Neuwiedia zollingeri var. singapureana] AIY61332.1 ribosomal protein S7 (chloroplast) [Apostasia odorata] AIY61333.1 ribosomal protein S7 (chloroplast) [Apostasia odorata] AKJ77427.1 ribosomal protein S7 (chloroplast) [Elleanthus sodiroi] AKJ77439.1 ribosomal protein S7 (chloroplast) [Elleanthus sodiroi] ALJ02026.1 ribosomal protein S7 (chloroplast) [Sobralia aff. bouchei HTK-2015] ALJ02038.1 ribosomal protein S7 (chloroplast) [Sobralia aff. bouchei HTK-2015] ALJ02113.1 ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] ALJ02122.1 ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] ALL53030.1 30S ribosomal protein S7 (chloroplast) [Bletilla striata] ALL53031.1 30S ribosomal protein S7 (chloroplast) [Bletilla striata] AMF83941.1 30S ribosomal protein S7 (chloroplast) [Bletilla ochracea] AMF83942.1 30S ribosomal protein S7 (chloroplast) [Bletilla ochracea] ANT72515.1 ribosomal protein S7 (chloroplast) [Cephalanthera longifolia] ANT72529.1 ribosomal protein S7 (chloroplast) [Cephalanthera longifolia] ANT72604.1 ribosomal protein S7 (chloroplast) [Epipactis mairei] ANT72615.1 ribosomal protein S7 (chloroplast) [Epipactis mairei] ANT72680.1 ribosomal protein S7 (plastid) [Cephalanthera humilis] ANT72689.1 ribosomal protein S7 (plastid) [Cephalanthera humilis] ANT72798.1 ribosomal protein S7 (chloroplast) [Epipactis veratrifolia] ANT72812.1 ribosomal protein S7 (chloroplast) [Epipactis veratrifolia] ANT72912.1 ribosomal protein S7 (chloroplast) [Neottia pinetorum] ANT72926.1 ribosomal protein S7 (chloroplast) [Neottia pinetorum] ANT72998.1 ribosomal protein S7 (chloroplast) [Listera fugongensis] ANT73011.1 ribosomal protein S7 (chloroplast) [Listera fugongensis] ANT73084.1 ribosomal protein S7 (chloroplast) [Neottia ovata] ANT73099.1 ribosomal protein S7 (chloroplast) [Neottia ovata] ANT73129.1 ribosomal protein S7 (plastid) [Neottia listeroides] ANT73134.1 ribosomal protein S7 (plastid) [Neottia listeroides] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >Q67IP2.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAN31961.1 ribosomal protein S7 (chloroplast) [Butomus umbellatus] AEK71815.1 ribosomal protein S7 (plastid) [Aristolochia littoralis] AEX01284.1 ribosomal protein S7 (plastid) [Posidonia australis] AEX01286.1 ribosomal protein S7 (plastid) [Amphibolis griffithii] AEX01294.1 ribosomal protein S7 (plastid) [Maundia triglochinoides] AEX01297.1 ribosomal protein S7 (plastid) [Triglochin maritima] AEX01300.1 ribosomal protein S7 (plastid) [Aponogeton distachyos] AEX01306.1 ribosomal protein S7 (plastid) [Orontium aquaticum] AEX94144.1 ribosomal protein S7 (chloroplast) [Gilliesia graminea] APZ83186.1 ribosomal protein S7 (chloroplast) [Symplocarpus renifolius] APZ83199.1 ribosomal protein S7 (chloroplast) [Symplocarpus renifolius] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >Q6EMB0.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAQ64531.1 ribosomal protein S7 (chloroplast) [Aristolochia macrophylla] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >Q6EMA4.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAQ64536.1 ribosomal protein S7 (chloroplast) [Canella winterana] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >Q6EM62.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAQ64579.1 ribosomal protein S7 (chloroplast) [Saruma henryi] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >Q6EM87.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAQ64554.1 ribosomal protein S7 (chloroplast) [Hydrangea macrophylla] ANN38977.1 ribosomal protein S7 (chloroplast) [Hydrangea serrata f. fertilis] ANN38992.1 ribosomal protein S7 (chloroplast) [Hydrangea serrata f. fertilis] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >Q9GFN2.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAG26095.1 ribosomal protein S7 (chloroplast) [Asarum canadense] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >YP_740248.1 ribosomal protein S7 [Liriodendron tulipifera] YP_740261.1 ribosomal protein S7 [Liriodendron tulipifera] YP_740611.1 ribosomal protein S7 [Platanus occidentalis] YP_740624.1 ribosomal protein S7 [Platanus occidentalis] YP_784433.1 ribosomal protein S7 [Drimys granadensis] YP_784446.1 ribosomal protein S7 [Drimys granadensis] YP_001294316.1 ribosomal protein S7 [Illicium oligandrum] YP_001294330.1 ribosomal protein S7 [Illicium oligandrum] YP_001294230.1 ribosomal protein S7 [Buxus microphylla] YP_001294244.1 ribosomal protein S7 [Buxus microphylla] YP_007476093.1 ribosomal protein S7 [Dasypogon bromeliifolius] YP_007476107.1 ribosomal protein S7 [Dasypogon bromeliifolius] YP_008963738.1 ribosomal protein S7 (chloroplast) [Liquidambar formosana] YP_008963751.1 ribosomal protein S7 (chloroplast) [Liquidambar formosana] YP_009027932.1 ribosomal protein S7 (chloroplast) (chloroplast) [Hirtella racemosa] YP_009027945.1 ribosomal protein S7 (chloroplast) (chloroplast) [Hirtella racemosa] YP_009028015.1 ribosomal protein S7 (chloroplast) (chloroplast) [Chrysobalanus icaco] YP_009028028.1 ribosomal protein S7 (chloroplast) (chloroplast) [Chrysobalanus icaco] YP_009028264.1 ribosomal protein S7 (chloroplast) (chloroplast) [Licania alba] YP_009028277.1 ribosomal protein S7 (chloroplast) (chloroplast) [Licania alba] YP_009028347.1 ribosomal protein S7 (chloroplast) (chloroplast) [Licania sprucei] YP_009028360.1 ribosomal protein S7 (chloroplast) (chloroplast) [Licania sprucei] YP_009045611.1 ribosomal protein S7 (chloroplast) [Cypripedium macranthos] YP_009045624.1 ribosomal protein S7 (chloroplast) [Cypripedium macranthos] YP_009028430.1 ribosomal protein S7 (chloroplast) [Hirtella physophora] YP_009028443.1 ribosomal protein S7 (chloroplast) [Hirtella physophora] YP_009092350.1 ribosomal protein S7 (chloroplast) [Macadamia integrifolia] YP_009092364.1 ribosomal protein S7 (chloroplast) [Macadamia integrifolia] YP_009114493.1 ribosomal protein S7 (chloroplast) [Paeonia obovata] YP_009114505.1 ribosomal protein S7 (chloroplast) [Paeonia obovata] YP_009183244.1 ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] YP_009183256.1 ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] YP_009228810.1 ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] YP_009228822.1 ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] YP_009231294.1 ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] YP_009231307.1 ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] YP_009234770.1 ribosomal protein S7 (chloroplast) [Sabia yunnanensis] YP_009234783.1 ribosomal protein S7 (chloroplast) [Sabia yunnanensis] YP_009236417.1 ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] YP_009236405.1 ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] YP_009262993.1 ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] YP_009263006.1 ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] YP_009263159.1 ribosomal protein S7 (chloroplast) [Atuna racemosa] YP_009263172.1 ribosomal protein S7 (chloroplast) [Atuna racemosa] YP_009263906.1 ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] YP_009263919.1 ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] YP_009263989.1 ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] YP_009264002.1 ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] YP_009264072.1 ribosomal protein S7 (chloroplast) [Dactyladenia floretii] YP_009264085.1 ribosomal protein S7 (chloroplast) [Dactyladenia floretii] YP_009264155.1 ribosomal protein S7 (chloroplast) [Exellodendron barbatum] YP_009264168.1 ribosomal protein S7 (chloroplast) [Exellodendron barbatum] YP_009264238.1 ribosomal protein S7 (chloroplast) [Gaulettia elata] YP_009264251.1 ribosomal protein S7 (chloroplast) [Gaulettia elata] YP_009264321.1 ribosomal protein S7 (chloroplast) [Grangeria borbonica] YP_009264334.1 ribosomal protein S7 (chloroplast) [Grangeria borbonica] YP_009264404.1 ribosomal protein S7 (chloroplast) [Hirtella macrosepala] YP_009264417.1 ribosomal protein S7 (chloroplast) [Hirtella macrosepala] YP_009264487.1 ribosomal protein S7 (chloroplast) [Hirtella suffulta] YP_009264500.1 ribosomal protein S7 (chloroplast) [Hirtella suffulta] YP_009264570.1 ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] YP_009264583.1 ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] YP_009264653.1 ribosomal protein S7 (chloroplast) [Hunga gerontogea] YP_009264666.1 ribosomal protein S7 (chloroplast) [Hunga gerontogea] YP_009264817.1 ribosomal protein S7 (chloroplast) [Licania canescens] YP_009264830.1 ribosomal protein S7 (chloroplast) [Licania canescens] YP_009264900.1 ribosomal protein S7 (chloroplast) [Licania glabriflora] YP_009264913.1 ribosomal protein S7 (chloroplast) [Licania glabriflora] YP_009264983.1 ribosomal protein S7 (chloroplast) [Licania macrophylla] YP_009264996.1 ribosomal protein S7 (chloroplast) [Licania macrophylla] YP_009265066.1 ribosomal protein S7 (chloroplast) [Licania majuscula] YP_009265079.1 ribosomal protein S7 (chloroplast) [Licania majuscula] YP_009265149.1 ribosomal protein S7 (chloroplast) [Licania membranacea] YP_009265162.1 ribosomal protein S7 (chloroplast) [Licania membranacea] YP_009265232.1 ribosomal protein S7 (chloroplast) [Licania michauxii] YP_009265245.1 ribosomal protein S7 (chloroplast) [Licania michauxii] YP_009265315.1 ribosomal protein S7 (chloroplast) [Licania micrantha] YP_009265328.1 ribosomal protein S7 (chloroplast) [Licania micrantha] YP_009265398.1 ribosomal protein S7 (chloroplast) [Licania minutiflora] YP_009265411.1 ribosomal protein S7 (chloroplast) [Licania minutiflora] YP_009265481.1 ribosomal protein S7 (chloroplast) [Licania ovalifolia] YP_009265494.1 ribosomal protein S7 (chloroplast) [Licania ovalifolia] YP_009265564.1 ribosomal protein S7 (chloroplast) [Licania tomentosa] YP_009265577.1 ribosomal protein S7 (chloroplast) [Licania tomentosa] YP_009265647.1 ribosomal protein S7 (chloroplast) [Magnistipula butayei] YP_009265660.1 ribosomal protein S7 (chloroplast) [Magnistipula butayei] YP_009265730.1 ribosomal protein S7 (chloroplast) [Maranthes gabunensis] YP_009265743.1 ribosomal protein S7 (chloroplast) [Maranthes gabunensis] YP_009265813.1 ribosomal protein S7 (chloroplast) [Maranthes glabra] YP_009265826.1 ribosomal protein S7 (chloroplast) [Maranthes glabra] YP_009265896.1 ribosomal protein S7 (chloroplast) [Maranthes kerstingii] YP_009265909.1 ribosomal protein S7 (chloroplast) [Maranthes kerstingii] YP_009262570.1 ribosomal protein S7 (chloroplast) [Acioa guianensis] YP_009262583.1 ribosomal protein S7 (chloroplast) [Acioa guianensis] YP_009333070.1 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] YP_009333082.1 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] YP_009334450.1 ribosomal protein S7 (chloroplast) [Albuca kirkii] YP_009334463.1 ribosomal protein S7 (chloroplast) [Albuca kirkii] YP_009334536.1 ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] YP_009334549.1 ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] YP_009334621.1 ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] YP_009334634.1 ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] YP_009334705.1 ribosomal protein S7 (chloroplast) [Camassia scilloides] YP_009334718.1 ribosomal protein S7 (chloroplast) [Camassia scilloides] YP_009334789.1 ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] YP_009334802.1 ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] YP_009334873.1 ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] YP_009334886.1 ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] YP_009334957.1 ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] YP_009334970.1 ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] YP_009335040.1 ribosomal protein S7 (chloroplast) [Hesperocallis undulata] YP_009335053.1 ribosomal protein S7 (chloroplast) [Hesperocallis undulata] YP_009335125.1 ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] YP_009335138.1 ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] YP_009335208.1 ribosomal protein S7 (chloroplast) [Hosta ventricosa] YP_009335221.1 ribosomal protein S7 (chloroplast) [Hosta ventricosa] YP_009335378.1 ribosomal protein S7 (chloroplast) [Nolina atopocarpa] YP_009335391.1 ribosomal protein S7 (chloroplast) [Nolina atopocarpa] YP_009335464.1 ribosomal protein S7 (chloroplast) [Oziroe biflora] YP_009335477.1 ribosomal protein S7 (chloroplast) [Oziroe biflora] YP_009335549.1 ribosomal protein S7 (chloroplast) [Schoenolirion croceum] YP_009335562.1 ribosomal protein S7 (chloroplast) [Schoenolirion croceum] YP_009341932.1 ribosomal protein S7 (chloroplast) [Aletris spicata] YP_009341919.1 ribosomal protein S7 (chloroplast) [Aletris spicata] YP_009342016.1 ribosomal protein S7 (chloroplast) [Aletris fauriei] YP_009342003.1 ribosomal protein S7 (chloroplast) [Aletris fauriei] Q67IB6.1 RecName: Full=30S ribosomal protein S7, chloroplastic Q67IE0.1 RecName: Full=30S ribosomal protein S7, chloroplastic Q6EM68.1 RecName: Full=30S ribosomal protein S7, chloroplastic P69663.1 RecName: Full=30S ribosomal protein S7, chloroplastic P69664.1 RecName: Full=30S ribosomal protein S7, chloroplastic P69665.1 RecName: Full=30S ribosomal protein S7, chloroplastic P69666.1 RecName: Full=30S ribosomal protein S7, chloroplastic Q67IB0.1 RecName: Full=30S ribosomal protein S7, chloroplastic Q67IE3.1 RecName: Full=30S ribosomal protein S7, chloroplastic Q06GT7.1 RecName: Full=30S ribosomal protein S7, chloroplastic A6MM82.1 RecName: Full=30S ribosomal protein S7, chloroplastic A6MMZ0.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAG26107.1 ribosomal protein S7 (chloroplast) [Cercidiphyllum japonicum] AAG26113.1 ribosomal protein S7 (chloroplast) [Drimys winteri] AAG26119.1 ribosomal protein S7 (chloroplast) [Illicium parviflorum] AAG26125.1 ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] AAQ14201.1 ribosomal protein S7 (chloroplast) [Austrobaileya scandens] AAQ64573.1 ribosomal protein S7 (chloroplast) [Platanus occidentalis] AAN31991.1 ribosomal protein S7 (chloroplast) [Dasypogon hookeri] AAN32022.1 ribosomal protein S7 (chloroplast) [Alania cunninghamii] AAN32025.1 ribosomal protein S7 (chloroplast) [Asphodelus albus] AAN32028.1 ribosomal protein S7 (chloroplast) [Astelia alpina] AAN32040.1 ribosomal protein S7 (chloroplast) [Cyanastrum cordifolium] AAN32045.1 ribosomal protein S7 (chloroplast) [Hemerocallis littorea] AAN32060.1 ribosomal protein S7 (chloroplast) [Phormium tenax] AAN32063.1 ribosomal protein S7 (chloroplast) [Sisyrinchium montanum] AAN32066.1 ribosomal protein S7 (chloroplast) [Xanthorrhoea resinosa] AAN32075.1 ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] AAN32087.1 ribosomal protein S7 (chloroplast) [Maianthemum racemosum] AAN32090.1 ribosomal protein S7 (chloroplast) [Muilla maritima] AAN32093.1 ribosomal protein S7 (chloroplast) [Leopoldia comosa] AAN32096.1 ribosomal protein S7 (chloroplast) [Narcissus elegans] ABH88343.1 ribosomal protein S7 (chloroplast) [Drimys granadensis] ABH88358.1 ribosomal protein S7 (chloroplast) [Drimys granadensis] ABI32555.1 ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] ABI32569.1 ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] ABI49825.1 ribosomal protein S7 (chloroplast) [Platanus occidentalis] ABI49838.1 ribosomal protein S7 (chloroplast) [Platanus occidentalis] ABQ14818.1 ribosomal protein S7 (chloroplast) [Cercidiphyllum japonicum] ABQ14826.1 ribosomal protein S7 (chloroplast) [Daphniphyllum sp. 205-82] ABQ14834.1 ribosomal protein S7 (chloroplast) [Hamamelis japonica] ABQ14886.1 ribosomal protein S7 (chloroplast) [Paeonia brownii] ABQ45294.1 ribosomal protein S7 (chloroplast) [Buxus microphylla] ABQ45310.1 ribosomal protein S7 (chloroplast) [Buxus microphylla] ABQ52564.1 ribosomal protein S7 (chloroplast) [Illicium oligandrum] ABQ52580.1 ribosomal protein S7 (chloroplast) [Illicium oligandrum] ADD29908.1 ribosomal protein S7 (chloroplast) [Liquidambar styraciflua] AEK71760.1 ribosomal protein S7 (plastid) [Liquidambar styraciflua] AEK71822.1 ribosomal protein S7 (plastid) [Hedyosmum mexicanum] AEK78132.1 ribosomal protein S7 (plastid) [Tasmannia lanceolata] AEX94136.1 ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] AEX94137.1 ribosomal protein S7 (chloroplast) [Camassia scilloides] AEX94139.1 ribosomal protein S7 (chloroplast) [Hosta ventricosa] AEX94146.1 ribosomal protein S7 (chloroplast) [Amaryllis belladonna] AEX94147.1 ribosomal protein S7 (chloroplast) [Crinum asiaticum] AEX94149.1 ribosomal protein S7 (chloroplast) [Scadoxus cinnabarinus] AEX94150.1 ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] AEX94155.1 ribosomal protein S7 (chloroplast) [Asphodeline damascena] AEX94157.1 ribosomal protein S7 (chloroplast) [Kniphofia linearifolia] AEX94159.1 ribosomal protein S7 (chloroplast) [Phormium tenax] AEX94161.1 ribosomal protein S7 (chloroplast) [Drimia altissima] AEX94162.1 ribosomal protein S7 (chloroplast) [Ledebouria cordifolia] AEX94163.1 ribosomal protein S7 (chloroplast) [Ornithogalum tenuifolium] AEX94164.1 ribosomal protein S7 (chloroplast) [Oziroe biflora] AEX94168.1 ribosomal protein S7 (chloroplast) [Beaucarnea hookeri] AEX94169.1 ribosomal protein S7 (chloroplast) [Dasylirion wheeleri] AEX94170.1 ribosomal protein S7 (chloroplast) [Eriospermum cervicorne] AEX94171.1 ribosomal protein S7 (chloroplast) [Liriope spicata] AEX94172.1 ribosomal protein S7 (chloroplast) [Ophiopogon japonicus] AEX94173.1 ribosomal protein S7 (chloroplast) [Ruscus aculeatus] AEX94174.1 ribosomal protein S7 (chloroplast) [Sansevieria trifasciata] AEX94175.1 ribosomal protein S7 (chloroplast) [Maianthemum stellatum] AEX94176.1 ribosomal protein S7 (chloroplast) [Androstephium coeruleum] AEX94181.1 ribosomal protein S7 (chloroplast) [Triteleia hyacinthina] AEX94182.1 ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] AFG25678.1 ribosomal protein S7 (plastid) [Albuca kirkii] AFG25688.1 ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] AFG25694.1 ribosomal protein S7, partial (plastid) [Hesperaloe parviflora] AFG25695.1 ribosomal protein S7, partial (plastid) [Hosta ventricosa] AFG25702.1 ribosomal protein S7, partial (plastid) [Neoastelia spectabilis] AFG25704.1 ribosomal protein S7, partial (plastid) [Nolina atopocarpa] AFG25706.1 ribosomal protein S7, partial (plastid) [Phormium tenax] AGE93157.1 ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] AGE93173.1 ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] AGL13477.1 ribosomal protein S7 (chloroplast) [Liquidambar formosana] AGL13490.1 ribosomal protein S7 (chloroplast) [Liquidambar formosana] AHB38205.1 ribosomal protein S7 (chloroplast) [Macadamia integrifolia] AHB38221.1 ribosomal protein S7 (chloroplast) [Macadamia integrifolia] AHI16794.1 ribosomal protein S7 (chloroplast) (chloroplast) [Cypripedium macranthos] AHI16807.1 ribosomal protein S7 (chloroplast) (chloroplast) [Cypripedium macranthos] AHV83399.1 ribosomal protein S7 (chloroplast) [Paeonia obovata] AHV83409.1 ribosomal protein S7 (chloroplast) [Paeonia obovata] AHX80652.1 ribosomal protein S7 (chloroplast) [Hirtella racemosa] AHX80653.1 ribosomal protein S7 (chloroplast) [Hirtella racemosa] AHX80735.1 ribosomal protein S7 (chloroplast) [Chrysobalanus icaco] AHX80736.1 ribosomal protein S7 (chloroplast) [Chrysobalanus icaco] AHX80984.1 ribosomal protein S7 (chloroplast) [Licania alba] AHX80985.1 ribosomal protein S7 (chloroplast) [Licania alba] AHX81067.1 ribosomal protein S7 (chloroplast) [Licania sprucei] AHX81068.1 ribosomal protein S7 (chloroplast) [Licania sprucei] AHX81150.1 ribosomal protein S7 (chloroplast) [Hirtella physophora] AHX81151.1 ribosomal protein S7 (chloroplast) [Hirtella physophora] AKR80939.1 ribosomal protein S7 (plastid) [Lophiola aurea] ALM87750.1 ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] ALM87751.1 ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] ALO71310.1 ribosomal protein S7 (chloroplast) [Ampelopsis glandulosa var. brevipedunculata] ALO71324.1 ribosomal protein S7 (chloroplast) [Ampelopsis glandulosa var. brevipedunculata] ALS19972.1 ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] ALS19973.1 ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] ALS20235.1 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] ALS20236.1 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] ALV25527.1 ribosomal protein S7 (chloroplast) [Aletris spicata] ALV25528.1 ribosomal protein S7 (chloroplast) [Aletris spicata] ALV25611.1 ribosomal protein S7 (chloroplast) [Aletris fauriei] ALV25612.1 ribosomal protein S7 (chloroplast) [Aletris fauriei] ALV89972.1 ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] ALV89985.1 ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] AMD08487.1 ribosomal protein S7 (chloroplast) [Sabia yunnanensis] AMD08500.1 ribosomal protein S7 (chloroplast) [Sabia yunnanensis] AMF84106.1 ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] AMF84107.1 ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] ANI87215.1 ribosomal protein S7 (chloroplast) [Acioa guianensis] ANI87216.1 ribosomal protein S7 (chloroplast) [Acioa guianensis] ANJ17111.1 ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] ANJ17112.1 ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] ANJ17276.1 ribosomal protein S7 (chloroplast) [Atuna racemosa] ANJ17277.1 ribosomal protein S7 (chloroplast) [Atuna racemosa] ANJ18107.1 ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] ANJ18108.1 ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] ANJ18190.1 ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] ANJ18191.1 ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] ANJ18273.1 ribosomal protein S7 (chloroplast) [Dactyladenia floretii] ANJ18274.1 ribosomal protein S7 (chloroplast) [Dactyladenia floretii] ANJ18356.1 ribosomal protein S7 (chloroplast) [Exellodendron barbatum] ANJ18357.1 ribosomal protein S7 (chloroplast) [Exellodendron barbatum] ANJ18439.1 ribosomal protein S7 (chloroplast) [Gaulettia elata] ANJ18440.1 ribosomal protein S7 (chloroplast) [Gaulettia elata] ANJ18522.1 ribosomal protein S7 (chloroplast) [Grangeria borbonica] ANJ18523.1 ribosomal protein S7 (chloroplast) [Grangeria borbonica] ANJ18605.1 ribosomal protein S7 (chloroplast) [Hirtella macrosepala] ANJ18606.1 ribosomal protein S7 (chloroplast) [Hirtella macrosepala] ANJ18688.1 ribosomal protein S7 (chloroplast) [Hirtella racemosa] ANJ18689.1 ribosomal protein S7 (chloroplast) [Hirtella racemosa] ANJ18771.1 ribosomal protein S7 (chloroplast) [Hirtella suffulta] ANJ18772.1 ribosomal protein S7 (chloroplast) [Hirtella suffulta] ANJ18854.1 ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] ANJ18855.1 ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] ANJ18937.1 ribosomal protein S7 (chloroplast) [Hunga gerontogea] ANJ18938.1 ribosomal protein S7 (chloroplast) [Hunga gerontogea] ANJ19101.1 ribosomal protein S7 (chloroplast) [Licania canescens] ANJ19102.1 ribosomal protein S7 (chloroplast) [Licania canescens] ANJ19184.1 ribosomal protein S7 (chloroplast) [Licania glabriflora] ANJ19185.1 ribosomal protein S7 (chloroplast) [Licania glabriflora] ANJ19267.1 ribosomal protein S7 (chloroplast) [Licania macrophylla] ANJ19268.1 ribosomal protein S7 (chloroplast) [Licania macrophylla] ANJ19350.1 ribosomal protein S7 (chloroplast) [Licania majuscula] ANJ19351.1 ribosomal protein S7 (chloroplast) [Licania majuscula] ANJ19433.1 ribosomal protein S7 (chloroplast) [Licania membranacea] ANJ19434.1 ribosomal protein S7 (chloroplast) [Licania membranacea] ANJ19516.1 ribosomal protein S7 (chloroplast) [Licania michauxii] ANJ19517.1 ribosomal protein S7 (chloroplast) [Licania michauxii] ANJ19618.1 ribosomal protein S7 (chloroplast) [Licania micrantha] ANJ19633.1 ribosomal protein S7 (chloroplast) [Licania micrantha] ANJ19701.1 ribosomal protein S7 (chloroplast) [Licania minutiflora] ANJ19716.1 ribosomal protein S7 (chloroplast) [Licania minutiflora] ANJ19784.1 ribosomal protein S7 (chloroplast) [Licania ovalifolia] ANJ19799.1 ribosomal protein S7 (chloroplast) [Licania ovalifolia] ANJ19867.1 ribosomal protein S7 (chloroplast) [Licania tomentosa] ANJ19882.1 ribosomal protein S7 (chloroplast) [Licania tomentosa] ANJ19950.1 ribosomal protein S7 (chloroplast) [Magnistipula butayei] ANJ19965.1 ribosomal protein S7 (chloroplast) [Magnistipula butayei] ANJ20014.1 ribosomal protein S7 (chloroplast) [Maranthes gabunensis] ANJ20015.1 ribosomal protein S7 (chloroplast) [Maranthes gabunensis] ANJ20097.1 ribosomal protein S7 (chloroplast) [Maranthes glabra] ANJ20098.1 ribosomal protein S7 (chloroplast) [Maranthes glabra] ANJ20180.1 ribosomal protein S7 (chloroplast) [Maranthes kerstingii] ANJ20181.1 ribosomal protein S7 (chloroplast) [Maranthes kerstingii] APO11260.1 ribosomal protein S7 (chloroplast) [Albuca kirkii] APO11273.1 ribosomal protein S7 (chloroplast) [Albuca kirkii] APO11346.1 ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] APO11359.1 ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] APO11430.1 ribosomal protein S7 (chloroplast) [Behnia reticulata] APO11443.1 ribosomal protein S7 (chloroplast) [Behnia reticulata] APO11514.1 ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] APO11527.1 ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] APO11598.1 ribosomal protein S7 (chloroplast) [Camassia scilloides] APO11611.1 ribosomal protein S7 (chloroplast) [Camassia scilloides] APO11682.1 ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] APO11695.1 ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] APO11931.1 ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] APO11944.1 ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] APO12015.1 ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] APO12028.1 ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] APO12098.1 ribosomal protein S7 (chloroplast) [Hesperocallis undulata] APO12111.1 ribosomal protein S7 (chloroplast) [Hesperocallis undulata] APO12183.1 ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] APO12196.1 ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] APO12266.1 ribosomal protein S7 (chloroplast) [Hosta ventricosa] APO12279.1 ribosomal protein S7 (chloroplast) [Hosta ventricosa] APO12436.1 ribosomal protein S7 (chloroplast) [Nolina atopocarpa] APO12449.1 ribosomal protein S7 (chloroplast) [Nolina atopocarpa] APO12522.1 ribosomal protein S7 (chloroplast) [Oziroe biflora] APO12535.1 ribosomal protein S7 (chloroplast) [Oziroe biflora] APO12693.1 ribosomal protein S7 (chloroplast) [Schoenolirion croceum] APO12706.1 ribosomal protein S7 (chloroplast) [Schoenolirion croceum] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >YP_009180153.1 ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] YP_009180165.1 ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] ALL96508.1 ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] ALL96509.1 ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >YP_009164362.1 ribosomal protein S7 (chloroplast) [Bupleurum falcatum] YP_009164376.1 ribosomal protein S7 (chloroplast) [Bupleurum falcatum] YP_009338552.1 ribosomal protein S7 (chloroplast) [Bupleurum latissimum] YP_009338565.1 ribosomal protein S7 (chloroplast) [Bupleurum latissimum] AIY72348.1 ribosomal protein S7 (chloroplast) [Bupleurum falcatum] AIY72362.1 ribosomal protein S7 (chloroplast) [Bupleurum falcatum] ANK36647.1 ribosomal protein S7 (chloroplast) [Bupleurum latissimum] ANK36660.1 ribosomal protein S7 (chloroplast) [Bupleurum latissimum] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102 >AIW51379.1 ribosomal protein S7 (plastid) [Corallorhiza maculata var. mexicana] AIW51387.1 ribosomal protein S7 (plastid) [Corallorhiza maculata var. mexicana] Length = 155 Score = 198 bits (503), Expect = 5e-63 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -2 Query: 306 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 127 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 126 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 1 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIR 102