BLASTX nr result
ID: Panax24_contig00024827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00024827 (836 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP70586.1 TBCC domain-containing protein 1 [Cajanus cajan] 70 6e-10 XP_007162298.1 hypothetical protein PHAVU_001G140300g [Phaseolus... 70 6e-10 XP_019166462.1 PREDICTED: TBCC domain-containing protein 1-like ... 70 8e-10 XP_009772589.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 XP_019254235.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 XP_009629812.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 KZV36387.1 TBCC domain-containing protein 1, partial [Dorcoceras... 69 1e-09 EPS74445.1 hypothetical protein M569_00304, partial [Genlisea au... 69 1e-09 XP_017418314.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 XP_014495733.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 XP_019166461.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 XP_010524365.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 XP_019187518.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 XP_010548390.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 1e-09 XP_017186649.1 PREDICTED: TBCC domain-containing protein 1-like ... 68 2e-09 XP_012857264.1 PREDICTED: TBCC domain-containing protein 1-like ... 69 2e-09 XP_020109903.1 TBCC domain-containing protein 1-like [Ananas com... 69 2e-09 XP_017192892.1 PREDICTED: TBCC domain-containing protein 1-like ... 68 2e-09 XP_019440832.1 PREDICTED: TBCC domain-containing protein 1-like ... 68 2e-09 CBI30042.3 unnamed protein product, partial [Vitis vinifera] 68 2e-09 >KYP70586.1 TBCC domain-containing protein 1 [Cajanus cajan] Length = 565 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSPLQLVRSNSRRFMPSQTDEEAHQL+ HL Sbjct: 147 AFDGYLSALSPLQLVRSNSRRFMPSQTDEEAHQLSYLQKHL 187 >XP_007162298.1 hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris] ESW34292.1 hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris] Length = 566 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSPLQLVRSNSRRFMPSQTDEEAHQL+ HL Sbjct: 147 AFDGYLSALSPLQLVRSNSRRFMPSQTDEEAHQLSFLQKHL 187 >XP_019166462.1 PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Ipomoea nil] Length = 568 Score = 69.7 bits (169), Expect = 8e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDGFLSALSPLQLVRSNSRRFMPSQ+DEEAHQL+ HL Sbjct: 150 AFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHL 190 >XP_009772589.1 PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris] XP_016474422.1 PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tabacum] XP_016474423.1 PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tabacum] Length = 568 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDGFLSALSPLQLVRSNSRRFMPSQ DEEAHQL+ HL Sbjct: 150 AFDGFLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHL 190 >XP_019254235.1 PREDICTED: TBCC domain-containing protein 1-like [Nicotiana attenuata] OIS97558.1 hypothetical protein A4A49_07089 [Nicotiana attenuata] Length = 570 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDGFLSALSPLQLVRSNSRRFMPSQ DEEAHQL+ HL Sbjct: 152 AFDGFLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHL 192 >XP_009629812.1 PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis] XP_016489843.1 PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tabacum] Length = 570 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDGFLSALSPLQLVRSNSRRFMPSQ DEEAHQL+ HL Sbjct: 152 AFDGFLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHL 192 >KZV36387.1 TBCC domain-containing protein 1, partial [Dorcoceras hygrometricum] Length = 571 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDGFLSALSPLQLVRSNSRRFMPSQ DEEAHQL+ HL Sbjct: 153 AFDGFLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHL 193 >EPS74445.1 hypothetical protein M569_00304, partial [Genlisea aurea] Length = 572 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLT 730 AFDGFLSALSPLQLVRSNSR+FMPSQTDEEAHQL+ Sbjct: 151 AFDGFLSALSPLQLVRSNSRKFMPSQTDEEAHQLS 185 >XP_017418314.1 PREDICTED: TBCC domain-containing protein 1-like [Vigna angularis] BAT85320.1 hypothetical protein VIGAN_04285200 [Vigna angularis var. angularis] Length = 564 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSPLQLVRSNSRRF+PSQTDEEAHQL+ HL Sbjct: 147 AFDGYLSALSPLQLVRSNSRRFLPSQTDEEAHQLSYLQKHL 187 >XP_014495733.1 PREDICTED: TBCC domain-containing protein 1-like [Vigna radiata var. radiata] Length = 566 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSPLQLVRSNSRRF+PSQTDEEAHQL+ HL Sbjct: 147 AFDGYLSALSPLQLVRSNSRRFLPSQTDEEAHQLSYLQKHL 187 >XP_019166461.1 PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Ipomoea nil] Length = 568 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDGFLSALSP+QLVRSNSRRFMPSQ+DEEAHQL+ HL Sbjct: 150 AFDGFLSALSPMQLVRSNSRRFMPSQSDEEAHQLSYLQKHL 190 >XP_010524365.1 PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana] Length = 569 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSP+QLVRSNSRRFMPSQTDEEAH LT HL Sbjct: 151 AFDGYLSALSPIQLVRSNSRRFMPSQTDEEAHHLTYLQKHL 191 >XP_019187518.1 PREDICTED: TBCC domain-containing protein 1-like [Ipomoea nil] Length = 574 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLT 730 AFDGFLSALSPLQLVRSNSRRFMPSQ+DEEAHQL+ Sbjct: 156 AFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLS 190 >XP_010548390.1 PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana] Length = 577 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSP+QLVRSNSRRFMPSQ DEEAHQLT HL Sbjct: 159 AFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLTYLQKHL 199 >XP_017186649.1 PREDICTED: TBCC domain-containing protein 1-like [Malus domestica] Length = 383 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSPLQLVRSNSRRFMPSQ DEEAHQL+ HL Sbjct: 147 AFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHL 187 >XP_012857264.1 PREDICTED: TBCC domain-containing protein 1-like [Erythranthe guttata] Length = 576 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLT 730 AFDGFLSALSPLQLVRSNSRRFMPSQ DEEAHQL+ Sbjct: 158 AFDGFLSALSPLQLVRSNSRRFMPSQADEEAHQLS 192 >XP_020109903.1 TBCC domain-containing protein 1-like [Ananas comosus] Length = 641 Score = 68.6 bits (166), Expect = 2e-09 Identities = 37/64 (57%), Positives = 46/64 (71%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHLLSYQKSSFTLTSYTKAGQL 655 AFDG+LSALSP+QLVRSNSRRFMPSQ DEEAHQL+ +L + + TL S + G+ Sbjct: 212 AFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLS----YLQKHMANILTLLSDSVEGEG 267 Query: 654 QSRL 643 + L Sbjct: 268 EDSL 271 >XP_017192892.1 PREDICTED: TBCC domain-containing protein 1-like [Malus domestica] Length = 453 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSPLQLVRSNSRRFMPSQ DEEAHQL+ HL Sbjct: 147 AFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHL 187 >XP_019440832.1 PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Lupinus angustifolius] Length = 458 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSPLQLVRSNSRRFMPSQ DEEAHQL+ HL Sbjct: 155 AFDGYLSALSPLQLVRSNSRRFMPSQVDEEAHQLSYLQKHL 195 >CBI30042.3 unnamed protein product, partial [Vitis vinifera] Length = 466 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 834 AFDGFLSALSPLQLVRSNSRRFMPSQTDEEAHQLTVGLCHL 712 AFDG+LSALSPLQLVRSNSRRFMPSQ DEEAHQL+ HL Sbjct: 48 AFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHL 88