BLASTX nr result
ID: Panax24_contig00024667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00024667 (599 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247281.1 PREDICTED: two-component response regulator-like ... 68 8e-10 EOX95582.1 Pseudo response regulator, putative isoform 1 [Theobr... 65 9e-09 XP_017985435.1 PREDICTED: two-component response regulator-like ... 65 9e-09 XP_017985434.1 PREDICTED: two-component response regulator-like ... 65 9e-09 XP_017985433.1 PREDICTED: two-component response regulator-like ... 65 9e-09 XP_017985432.1 PREDICTED: two-component response regulator-like ... 65 9e-09 XP_017985431.1 PREDICTED: two-component response regulator-like ... 65 9e-09 CBI16233.3 unnamed protein product, partial [Vitis vinifera] 60 1e-08 OMO82360.1 hypothetical protein COLO4_23051 [Corchorus olitorius] 64 2e-08 OMO64191.1 hypothetical protein CCACVL1_21964 [Corchorus capsula... 64 2e-08 OAY48931.1 hypothetical protein MANES_05G016200 [Manihot esculen... 64 2e-08 XP_009357612.1 PREDICTED: two-component response regulator-like ... 64 2e-08 XP_017190799.1 PREDICTED: two-component response regulator-like ... 63 3e-08 XP_018719274.1 PREDICTED: LOW QUALITY PROTEIN: two-component res... 62 6e-08 OAY51725.1 hypothetical protein MANES_04G027400 [Manihot esculenta] 62 7e-08 XP_019432881.1 PREDICTED: two-component response regulator-like ... 62 8e-08 OIW21384.1 hypothetical protein TanjilG_02529 [Lupinus angustifo... 62 8e-08 XP_019432880.1 PREDICTED: two-component response regulator-like ... 62 8e-08 XP_016456691.1 PREDICTED: two-component response regulator-like ... 62 8e-08 XP_009605296.1 PREDICTED: two-component response regulator-like ... 62 8e-08 >XP_017247281.1 PREDICTED: two-component response regulator-like APRR3 [Daucus carota subsp. sativus] XP_017247282.1 PREDICTED: two-component response regulator-like APRR3 [Daucus carota subsp. sativus] KZM97383.1 hypothetical protein DCAR_015255 [Daucus carota subsp. sativus] Length = 717 Score = 67.8 bits (164), Expect = 8e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGDPNS 483 F+KKVRY +RK+LAEQRPRVKGQFVRQ + EDKI DPNS Sbjct: 679 FDKKVRYHNRKKLAEQRPRVKGQFVRQAVVEDKISDPNS 717 >EOX95582.1 Pseudo response regulator, putative isoform 1 [Theobroma cacao] Length = 605 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRYQSRKRLAEQRPRV+GQFVRQV +E +GD Sbjct: 564 FEKKVRYQSRKRLAEQRPRVRGQFVRQVQNETPVGD 599 >XP_017985435.1 PREDICTED: two-component response regulator-like APRR9 isoform X5 [Theobroma cacao] Length = 647 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRYQSRKRLAEQRPRV+GQFVRQV +E +GD Sbjct: 606 FEKKVRYQSRKRLAEQRPRVRGQFVRQVQNETPVGD 641 >XP_017985434.1 PREDICTED: two-component response regulator-like APRR9 isoform X4 [Theobroma cacao] Length = 666 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRYQSRKRLAEQRPRV+GQFVRQV +E +GD Sbjct: 625 FEKKVRYQSRKRLAEQRPRVRGQFVRQVQNETPVGD 660 >XP_017985433.1 PREDICTED: two-component response regulator-like APRR3 isoform X3 [Theobroma cacao] Length = 687 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRYQSRKRLAEQRPRV+GQFVRQV +E +GD Sbjct: 646 FEKKVRYQSRKRLAEQRPRVRGQFVRQVQNETPVGD 681 >XP_017985432.1 PREDICTED: two-component response regulator-like APRR3 isoform X2 [Theobroma cacao] Length = 705 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRYQSRKRLAEQRPRV+GQFVRQV +E +GD Sbjct: 664 FEKKVRYQSRKRLAEQRPRVRGQFVRQVQNETPVGD 699 >XP_017985431.1 PREDICTED: two-component response regulator-like APRR3 isoform X1 [Theobroma cacao] Length = 706 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRYQSRKRLAEQRPRV+GQFVRQV +E +GD Sbjct: 665 FEKKVRYQSRKRLAEQRPRVRGQFVRQVQNETPVGD 700 >CBI16233.3 unnamed protein product, partial [Vitis vinifera] Length = 103 Score = 60.5 bits (145), Expect = 1e-08 Identities = 30/45 (66%), Positives = 37/45 (82%), Gaps = 6/45 (13%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIG------DPNS 483 FEKKVRYQSRK+LAEQRPR++GQFVRQ +S++K G DP+S Sbjct: 49 FEKKVRYQSRKKLAEQRPRIRGQFVRQNVSDNKAGKDGQSDDPSS 93 >OMO82360.1 hypothetical protein COLO4_23051 [Corchorus olitorius] Length = 437 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRYQSRKRLAEQRPRV+GQFVRQV ++ +GD Sbjct: 396 FEKKVRYQSRKRLAEQRPRVRGQFVRQVQNDTPVGD 431 >OMO64191.1 hypothetical protein CCACVL1_21964 [Corchorus capsularis] Length = 624 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRYQSRKRLAEQRPRV+GQFVRQV ++ +GD Sbjct: 583 FEKKVRYQSRKRLAEQRPRVRGQFVRQVQNDTPVGD 618 >OAY48931.1 hypothetical protein MANES_05G016200 [Manihot esculenta] OAY48932.1 hypothetical protein MANES_05G016200 [Manihot esculenta] Length = 694 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGDPNS*P 477 +EKKVRY+SRKRLAEQRPRVKGQFVRQV +E D N+ P Sbjct: 654 YEKKVRYESRKRLAEQRPRVKGQFVRQVQNESPTADANNRP 694 >XP_009357612.1 PREDICTED: two-component response regulator-like PRR37 [Pyrus x bretschneideri] Length = 740 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGDPNS 483 FEKKVRYQSRK+LAEQRPRV+GQFVRQV++E+K D +S Sbjct: 702 FEKKVRYQSRKKLAEQRPRVRGQFVRQVVNENKGNDTDS 740 >XP_017190799.1 PREDICTED: two-component response regulator-like PRR37 [Malus domestica] Length = 404 Score = 63.2 bits (152), Expect = 3e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGDPNS 483 FEKKVRYQSRK+LAEQRPRV+GQFVRQV+ E+K D +S Sbjct: 366 FEKKVRYQSRKKLAEQRPRVRGQFVRQVVKENKGNDTDS 404 >XP_018719274.1 PREDICTED: LOW QUALITY PROTEIN: two-component response regulator-like PRR37 [Eucalyptus grandis] Length = 789 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEK+VRY+SRK+LAEQRPRV+GQFVRQ+ S+ K+GD Sbjct: 736 FEKRVRYESRKKLAEQRPRVRGQFVRQITSDSKMGD 771 >OAY51725.1 hypothetical protein MANES_04G027400 [Manihot esculenta] Length = 528 Score = 62.0 bits (149), Expect = 7e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIG 495 FEK+VRYQSRKRLAEQRPRVKGQF+RQ SE IG Sbjct: 475 FEKRVRYQSRKRLAEQRPRVKGQFIRQTTSESPIG 509 >XP_019432881.1 PREDICTED: two-component response regulator-like PRR95 isoform X2 [Lupinus angustifolius] Length = 656 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 F+KKVRYQSRKRLAEQRPRVKGQFVRQV +E++I + Sbjct: 616 FDKKVRYQSRKRLAEQRPRVKGQFVRQVNNENQIAE 651 >OIW21384.1 hypothetical protein TanjilG_02529 [Lupinus angustifolius] Length = 673 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 F+KKVRYQSRKRLAEQRPRVKGQFVRQV +E++I + Sbjct: 633 FDKKVRYQSRKRLAEQRPRVKGQFVRQVNNENQIAE 668 >XP_019432880.1 PREDICTED: two-component response regulator-like PRR95 isoform X1 [Lupinus angustifolius] Length = 675 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 F+KKVRYQSRKRLAEQRPRVKGQFVRQV +E++I + Sbjct: 635 FDKKVRYQSRKRLAEQRPRVKGQFVRQVNNENQIAE 670 >XP_016456691.1 PREDICTED: two-component response regulator-like APRR9 isoform X1 [Nicotiana tabacum] Length = 678 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRY+SRK+LAEQRPRVKGQFVRQV SE ++G+ Sbjct: 642 FEKKVRYESRKKLAEQRPRVKGQFVRQVPSEPQMGN 677 >XP_009605296.1 PREDICTED: two-component response regulator-like APRR9 isoform X2 [Nicotiana tomentosiformis] Length = 678 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 599 FEKKVRYQSRKRLAEQRPRVKGQFVRQVMSEDKIGD 492 FEKKVRY+SRK+LAEQRPRVKGQFVRQV SE ++G+ Sbjct: 642 FEKKVRYESRKKLAEQRPRVKGQFVRQVPSEPQMGN 677