BLASTX nr result
ID: Panax24_contig00024620
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00024620 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013469976.1 transmembrane protein, putative, partial [Medicag... 60 5e-09 >XP_013469976.1 transmembrane protein, putative, partial [Medicago truncatula] KEH44014.1 transmembrane protein, putative, partial [Medicago truncatula] Length = 97 Score = 59.7 bits (143), Expect = 5e-09 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 2/73 (2%) Frame = -2 Query: 430 HRDTLHKDT-HNQGTRNRGTLLRAAIRPNTLLSTHPSTLRRRLLNKAKAV-VSWKAVWLL 257 HRD LHK T HN+ + L N LLST L L++K +AV V+WKA WLL Sbjct: 15 HRDILHKVTLHNRAIHLKAILHNRVTHRNMLLST----LSHHLVSKVQAVLVAWKAAWLL 70 Query: 256 SAVAVYWMRAFDE 218 SAVAV WM AF++ Sbjct: 71 SAVAVSWMHAFEK 83