BLASTX nr result
ID: Panax24_contig00024367
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00024367 (549 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247458.1 PREDICTED: receptor-like protein kinase HERK 1 [D... 57 4e-06 >XP_017247458.1 PREDICTED: receptor-like protein kinase HERK 1 [Daucus carota subsp. sativus] KZM97053.1 hypothetical protein DCAR_015585 [Daucus carota subsp. sativus] Length = 834 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 547 DTTTSAVQREMPVVDDDDLSGVSMSRVFSQLVKSEGR 437 D+TTSA Q +M VVDDD LSGVSMSRVFSQLVKSEGR Sbjct: 799 DSTTSAGQHDMSVVDDD-LSGVSMSRVFSQLVKSEGR 834