BLASTX nr result
ID: Panax24_contig00024252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00024252 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235572.1 PREDICTED: beclin-1-like protein [Daucus carota s... 65 2e-09 XP_010261575.1 PREDICTED: beclin-1-like protein [Nelumbo nucifera] 61 5e-08 XP_010095773.1 Beclin-1-like protein [Morus notabilis] EXB62193.... 58 4e-07 XP_015888692.1 PREDICTED: beclin-1-like protein [Ziziphus jujuba] 57 8e-07 XP_008233183.1 PREDICTED: beclin-1-like protein [Prunus mume] 57 2e-06 XP_017188987.1 PREDICTED: beclin-1-like protein [Malus domestica] 56 2e-06 KYP59755.1 Beclin-1-like protein [Cajanus cajan] 55 4e-06 NP_001281034.1 beclin-1-like protein [Malus domestica] CAJ27522.... 55 5e-06 CAJ27523.1 beclin 1 protein [Medicago truncatula] 55 5e-06 KHN15233.1 Beclin-1-like protein [Glycine soja] 55 5e-06 XP_003598646.2 autophagy protein beclin 1 [Medicago truncatula] ... 55 5e-06 XP_003522951.1 PREDICTED: beclin-1-like protein isoform X1 [Glyc... 55 5e-06 CAJ27521.1 beclin 1 protein [Solanum lycopersicum] 55 5e-06 XP_011656818.1 PREDICTED: beclin-1-like protein isoform X2 [Cucu... 55 7e-06 XP_004140531.1 PREDICTED: beclin-1-like protein isoform X1 [Cucu... 55 7e-06 GAU39309.1 hypothetical protein TSUD_119140 [Trifolium subterran... 54 1e-05 XP_008354025.1 PREDICTED: beclin-1-like protein [Malus domestica] 54 1e-05 XP_008351165.1 PREDICTED: beclin-1-like protein [Malus domestica] 54 1e-05 XP_004514652.1 PREDICTED: beclin-1-like protein [Cicer arietinum] 54 1e-05 >XP_017235572.1 PREDICTED: beclin-1-like protein [Daucus carota subsp. sativus] KZN04547.1 hypothetical protein DCAR_005384 [Daucus carota subsp. sativus] Length = 535 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQNSSSN 323 VGNTNFQPLSGTVSS AEVP + SMYK+ NSKSE Q+SS++ Sbjct: 493 VGNTNFQPLSGTVSSRAEVPPASSMYKSRTSNSKSELQSSSNS 535 >XP_010261575.1 PREDICTED: beclin-1-like protein [Nelumbo nucifera] Length = 524 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQNSSS 326 VGNTNFQPLS VSSHAEVPA GS+Y H +SKSE +N S+ Sbjct: 482 VGNTNFQPLSAIVSSHAEVPAMGSLYSKHATDSKSESRNLSN 523 >XP_010095773.1 Beclin-1-like protein [Morus notabilis] EXB62193.1 Beclin-1-like protein [Morus notabilis] Length = 513 Score = 58.2 bits (139), Expect = 4e-07 Identities = 29/41 (70%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMY-KNHNPNSKSEFQNS 332 VGNTNFQPLS VSSHAEVPA+GS+Y K +SKS+F+NS Sbjct: 470 VGNTNFQPLSAMVSSHAEVPAAGSLYAKRGGSDSKSQFRNS 510 >XP_015888692.1 PREDICTED: beclin-1-like protein [Ziziphus jujuba] Length = 510 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQNS 332 VG+TNFQPLS VSSHAEVPA GS+Y + +SK EF+NS Sbjct: 471 VGSTNFQPLSAMVSSHAEVPAVGSLYTKRSSDSKLEFRNS 510 >XP_008233183.1 PREDICTED: beclin-1-like protein [Prunus mume] Length = 507 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQNSSS 326 VGNTNFQPLS VSSHAEVP GS+Y +SKSEF+NSS+ Sbjct: 466 VGNTNFQPLSA-VSSHAEVPGVGSLYTRRATDSKSEFRNSSN 506 >XP_017188987.1 PREDICTED: beclin-1-like protein [Malus domestica] Length = 509 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 451 VGNTNFQPLSGTVSS-HAEVPASGSMYKNHNPNSKSEFQNSS 329 VGNTNFQPLS VSS HAEV GS+Y + +SKSEFQNSS Sbjct: 466 VGNTNFQPLSAVVSSSHAEVSGVGSLYSRRSTDSKSEFQNSS 507 >KYP59755.1 Beclin-1-like protein [Cajanus cajan] Length = 475 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSSHAEVPA GS+Y ++KSE +N Sbjct: 437 VGNTNFQPLSAMVSSHAEVPAVGSLYTKRGSDAKSESRN 475 >NP_001281034.1 beclin-1-like protein [Malus domestica] CAJ27522.1 beclin 1 protein [Malus domestica] Length = 505 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -1 Query: 451 VGNTNFQPLSGTVSS-HAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSS HAEV +GS Y + NSKSEFQN Sbjct: 466 VGNTNFQPLSAVVSSSHAEVSGTGSSYSRRSTNSKSEFQN 505 >CAJ27523.1 beclin 1 protein [Medicago truncatula] Length = 508 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSSHAEVPA GS+Y +KSE +N Sbjct: 470 VGNTNFQPLSAMVSSHAEVPAVGSLYPKRGTEAKSESRN 508 >KHN15233.1 Beclin-1-like protein [Glycine soja] Length = 509 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSSHAEVPA GS+Y ++KSE +N Sbjct: 471 VGNTNFQPLSAMVSSHAEVPAVGSLYTKRGVDAKSESRN 509 >XP_003598646.2 autophagy protein beclin 1 [Medicago truncatula] AES68897.2 autophagy protein beclin 1 [Medicago truncatula] Length = 509 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSSHAEVPA GS+Y +KSE +N Sbjct: 471 VGNTNFQPLSAMVSSHAEVPAVGSLYPKRGTEAKSESRN 509 >XP_003522951.1 PREDICTED: beclin-1-like protein isoform X1 [Glycine max] KRH62897.1 hypothetical protein GLYMA_04G141000 [Glycine max] Length = 509 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSSHAEVPA GS+Y ++KSE +N Sbjct: 471 VGNTNFQPLSAMVSSHAEVPAVGSLYTKRGVDAKSESRN 509 >CAJ27521.1 beclin 1 protein [Solanum lycopersicum] Length = 523 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVP-ASGSMYKNHNPNSK 350 VGNTNFQPLSGTVSS AEVP A+GS+Y NH N+K Sbjct: 486 VGNTNFQPLSGTVSSQAEVPAAAGSLYSNHPTNTK 520 >XP_011656818.1 PREDICTED: beclin-1-like protein isoform X2 [Cucumis sativus] Length = 471 Score = 54.7 bits (130), Expect = 7e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQNSSS 326 VGNTNFQPLS SSH +VP+ GS Y +SKS+++NSSS Sbjct: 429 VGNTNFQPLSAITSSHDKVPSVGSFYTKRGADSKSDYRNSSS 470 >XP_004140531.1 PREDICTED: beclin-1-like protein isoform X1 [Cucumis sativus] KGN46469.1 hypothetical protein Csa_6G095850 [Cucumis sativus] Length = 509 Score = 54.7 bits (130), Expect = 7e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQNSSS 326 VGNTNFQPLS SSH +VP+ GS Y +SKS+++NSSS Sbjct: 467 VGNTNFQPLSAITSSHDKVPSVGSFYTKRGADSKSDYRNSSS 508 >GAU39309.1 hypothetical protein TSUD_119140 [Trifolium subterraneum] Length = 483 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSSHAEVPA GS+Y + KSE +N Sbjct: 445 VGNTNFQPLSAMVSSHAEVPAVGSLYPKRGTDVKSESRN 483 >XP_008354025.1 PREDICTED: beclin-1-like protein [Malus domestica] Length = 507 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -1 Query: 451 VGNTNFQPLSGTVSS-HAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSS HAEV +GS Y + NSKSEFQN Sbjct: 468 VGNTNFQPLSPAVSSSHAEVSGTGSSYSRRSTNSKSEFQN 507 >XP_008351165.1 PREDICTED: beclin-1-like protein [Malus domestica] Length = 507 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -1 Query: 451 VGNTNFQPLSGTVSS-HAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSS HAEV +GS Y + NSKSEFQN Sbjct: 468 VGNTNFQPLSPAVSSSHAEVSGTGSSYSRRSTNSKSEFQN 507 >XP_004514652.1 PREDICTED: beclin-1-like protein [Cicer arietinum] Length = 507 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 451 VGNTNFQPLSGTVSSHAEVPASGSMYKNHNPNSKSEFQN 335 VGNTNFQPLS VSSHAEVPA GS+Y +KSE +N Sbjct: 469 VGNTNFQPLSAMVSSHAEVPAVGSLYPKRGIEAKSESRN 507