BLASTX nr result
ID: Panax24_contig00023717
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00023717 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017227299.1 PREDICTED: probable protein phosphatase 2C 5 [Dau... 61 2e-08 KZM81758.1 hypothetical protein DCAR_029371 [Daucus carota subsp... 61 2e-08 XP_007031084.1 PREDICTED: probable protein phosphatase 2C 5 isof... 59 1e-07 KYP71277.1 putative protein phosphatase 2C 5 [Cajanus cajan] 59 1e-07 XP_004494559.1 PREDICTED: probable protein phosphatase 2C 5 [Cic... 59 1e-07 XP_017977704.1 PREDICTED: probable protein phosphatase 2C 5 isof... 59 1e-07 KJB45380.1 hypothetical protein B456_007G303500 [Gossypium raimo... 58 3e-07 KJB45378.1 hypothetical protein B456_007G303500 [Gossypium raimo... 58 3e-07 ABK92834.1 unknown [Populus trichocarpa] 55 4e-07 XP_003626183.1 protein phosphatase 2C family protein [Medicago t... 57 5e-07 KHG19035.1 hypothetical protein F383_08660 [Gossypium arboreum] 57 7e-07 XP_016713734.1 PREDICTED: probable protein phosphatase 2C 5 [Gos... 57 7e-07 CAN74505.1 hypothetical protein VITISV_015889 [Vitis vinifera] 57 7e-07 GAU11457.1 hypothetical protein TSUD_344480 [Trifolium subterran... 57 7e-07 XP_002282985.1 PREDICTED: probable protein phosphatase 2C 5 [Vit... 57 7e-07 OMP11460.1 phosphatase 2C (PP2C)-like protein [Corchorus olitorius] 56 9e-07 XP_006604795.1 PREDICTED: probable protein phosphatase 2C 5 isof... 56 1e-06 XP_014627522.1 PREDICTED: probable protein phosphatase 2C 5 isof... 56 1e-06 XP_014628430.1 PREDICTED: probable protein phosphatase 2C 5 isof... 56 1e-06 XP_017416032.1 PREDICTED: probable protein phosphatase 2C 5 isof... 56 1e-06 >XP_017227299.1 PREDICTED: probable protein phosphatase 2C 5 [Daucus carota subsp. sativus] Length = 431 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVTV 90 PWEGPFLCTNCRKKKDAMEGK GTR T V Sbjct: 402 PWEGPFLCTNCRKKKDAMEGKIGTRPTAAV 431 >KZM81758.1 hypothetical protein DCAR_029371 [Daucus carota subsp. sativus] Length = 436 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVTV 90 PWEGPFLCTNCRKKKDAMEGK GTR T V Sbjct: 407 PWEGPFLCTNCRKKKDAMEGKIGTRPTAAV 436 >XP_007031084.1 PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Theobroma cacao] XP_017977705.1 PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Theobroma cacao] EOY11586.1 Phosphatase 2C family protein [Theobroma cacao] Length = 428 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNCRKKKDAMEGK +R TVT Sbjct: 399 PWEGPFLCTNCRKKKDAMEGKRPSRPTVT 427 >KYP71277.1 putative protein phosphatase 2C 5 [Cajanus cajan] Length = 429 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNCRKKKDAMEGK +R TVT Sbjct: 400 PWEGPFLCTNCRKKKDAMEGKRPSRPTVT 428 >XP_004494559.1 PREDICTED: probable protein phosphatase 2C 5 [Cicer arietinum] XP_004494560.1 PREDICTED: probable protein phosphatase 2C 5 [Cicer arietinum] Length = 429 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNCRKKKDAMEGK +R TVT Sbjct: 399 PWEGPFLCTNCRKKKDAMEGKRPSRPTVT 427 >XP_017977704.1 PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Theobroma cacao] Length = 451 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNCRKKKDAMEGK +R TVT Sbjct: 422 PWEGPFLCTNCRKKKDAMEGKRPSRPTVT 450 >KJB45380.1 hypothetical protein B456_007G303500 [Gossypium raimondii] Length = 418 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTV 84 PWEGPFLCTNCRKKKDAMEGK +R TV Sbjct: 389 PWEGPFLCTNCRKKKDAMEGKRSSRPTV 416 >KJB45378.1 hypothetical protein B456_007G303500 [Gossypium raimondii] KJB45379.1 hypothetical protein B456_007G303500 [Gossypium raimondii] KJB45381.1 hypothetical protein B456_007G303500 [Gossypium raimondii] Length = 420 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTV 84 PWEGPFLCTNCRKKKDAMEGK +R TV Sbjct: 391 PWEGPFLCTNCRKKKDAMEGKRSSRPTV 418 >ABK92834.1 unknown [Populus trichocarpa] Length = 113 Score = 54.7 bits (130), Expect = 4e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTV 84 PWEGPFLC+NC+KKKDAMEGK +R TV Sbjct: 84 PWEGPFLCSNCQKKKDAMEGKRSSRPTV 111 >XP_003626183.1 protein phosphatase 2C family protein [Medicago truncatula] AES82401.1 protein phosphatase 2C family protein [Medicago truncatula] Length = 428 Score = 57.0 bits (136), Expect = 5e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNCR KKDAMEGK +R TVT Sbjct: 399 PWEGPFLCTNCRNKKDAMEGKRPSRPTVT 427 >KHG19035.1 hypothetical protein F383_08660 [Gossypium arboreum] Length = 397 Score = 56.6 bits (135), Expect = 7e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTV 84 PWEGPFLCTNCRKKKDAMEGK R TV Sbjct: 368 PWEGPFLCTNCRKKKDAMEGKRSGRPTV 395 >XP_016713734.1 PREDICTED: probable protein phosphatase 2C 5 [Gossypium hirsutum] Length = 403 Score = 56.6 bits (135), Expect = 7e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTV 84 PWEGPFLCTNCRKKKDAMEGK R TV Sbjct: 374 PWEGPFLCTNCRKKKDAMEGKRSGRPTV 401 >CAN74505.1 hypothetical protein VITISV_015889 [Vitis vinifera] Length = 406 Score = 56.6 bits (135), Expect = 7e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLC NCRKKKDAMEGK +R T+T Sbjct: 377 PWEGPFLCANCRKKKDAMEGKRPSRPTIT 405 >GAU11457.1 hypothetical protein TSUD_344480 [Trifolium subterraneum] Length = 430 Score = 56.6 bits (135), Expect = 7e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNCRKKKDAMEGK + TVT Sbjct: 400 PWEGPFLCTNCRKKKDAMEGKRPSSPTVT 428 >XP_002282985.1 PREDICTED: probable protein phosphatase 2C 5 [Vitis vinifera] CBI39560.3 unnamed protein product, partial [Vitis vinifera] Length = 430 Score = 56.6 bits (135), Expect = 7e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLC NCRKKKDAMEGK +R T+T Sbjct: 401 PWEGPFLCANCRKKKDAMEGKRPSRPTIT 429 >OMP11460.1 phosphatase 2C (PP2C)-like protein [Corchorus olitorius] Length = 377 Score = 56.2 bits (134), Expect = 9e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTV 84 PWEGPFLC+NCRKKKDAMEGK +R TV Sbjct: 348 PWEGPFLCSNCRKKKDAMEGKRASRPTV 375 >XP_006604795.1 PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Glycine max] KRG96747.1 hypothetical protein GLYMA_19G230200 [Glycine max] Length = 427 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNC KKKDAMEGK +R TVT Sbjct: 398 PWEGPFLCTNCWKKKDAMEGKKPSRPTVT 426 >XP_014627522.1 PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Glycine max] KHN43329.1 Hypothetical protein glysoja_001912 [Glycine soja] KRG96748.1 hypothetical protein GLYMA_19G230200 [Glycine max] Length = 429 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNC KKKDAMEGK +R TVT Sbjct: 400 PWEGPFLCTNCWKKKDAMEGKKPSRPTVT 428 >XP_014628430.1 PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Glycine max] XP_014628431.1 PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Glycine max] KRG92938.1 hypothetical protein GLYMA_20G238700 [Glycine max] Length = 329 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTVT 87 PWEGPFLCTNC+KKKDAMEGK TR + T Sbjct: 300 PWEGPFLCTNCQKKKDAMEGKRSTRPSET 328 >XP_017416032.1 PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Vigna angularis] Length = 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 1 PWEGPFLCTNCRKKKDAMEGKSGTRHTV 84 PWEGPFLCTNCRKKKDAMEGK ++ TV Sbjct: 398 PWEGPFLCTNCRKKKDAMEGKRPSKTTV 425