BLASTX nr result
ID: Panax24_contig00023716
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00023716 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_049820116.1 hypothetical protein [Bacillus thuringiensis] 54 5e-06 AFU13482.1 200 kDa antigen p200 [Bacillus thuringiensis MC28] 54 5e-06 WP_000795520.1 MULTISPECIES: hypothetical protein [Bacillus cere... 54 7e-06 EEL22668.1 hypothetical protein bcere0017_26720 [Bacillus cereus... 54 7e-06 >WP_049820116.1 hypothetical protein [Bacillus thuringiensis] Length = 418 Score = 54.3 bits (129), Expect = 5e-06 Identities = 35/118 (29%), Positives = 59/118 (50%), Gaps = 6/118 (5%) Frame = -1 Query: 373 MEVEKLKPVDSFSMEVETNSNTVVMETENSKSGVIVSDAAVDCEANPTFVVS------LD 212 +E+EK +S E E T+ E E+ ++ + ++ E S ++ Sbjct: 19 IELEK----ESKETESEKEEETIESEKESKETESEKEEETIESEKESKETESKKGDKAIE 74 Query: 211 VERPSLDVETQKESEVMEVEKPSLDVGKQKESEVLEVEKPSLDVLIQKESEVSEGEKD 38 +E+ S + E++KE E ME+EK S + +KE E +E EK S + +KE E E EK+ Sbjct: 75 LEKESKETESKKEEETMELEKESKETESEKEEETIESEKESKETESEKEEETIESEKE 132 Score = 53.9 bits (128), Expect = 7e-06 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 6/109 (5%) Frame = -1 Query: 346 DSFSMEVETNSNTVVMETENSKSGVIVSDAAVDCEANPTFVVS------LDVERPSLDVE 185 +S E E T+ E E+ ++ D A++ E S +++E+ S + E Sbjct: 42 ESKETESEKEEETIESEKESKETESKKGDKAIELEKESKETESKKEEETMELEKESKETE 101 Query: 184 TQKESEVMEVEKPSLDVGKQKESEVLEVEKPSLDVLIQKESEVSEGEKD 38 ++KE E +E EK S + +KE E +E EK S + +KE E E EK+ Sbjct: 102 SEKEEETIESEKESKETESEKEEETIESEKESKETESKKEEETIESEKE 150 >AFU13482.1 200 kDa antigen p200 [Bacillus thuringiensis MC28] Length = 518 Score = 54.3 bits (129), Expect = 5e-06 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 6/109 (5%) Frame = -1 Query: 346 DSFSMEVETNSNTVVMETENSKSGVIVSDAAVDCEANPTFVVS------LDVERPSLDVE 185 +S E + + +E EN ++ D A++ E S +++E+ S + E Sbjct: 52 ESKKTESKKGDKAIELEKENKETESKKGDKAIELEKENKETESKKGDKAIELEKKSKETE 111 Query: 184 TQKESEVMEVEKPSLDVGKQKESEVLEVEKPSLDVLIQKESEVSEGEKD 38 ++KE E +E+EK S + +KE E +E EK S + +KE E E EK+ Sbjct: 112 SKKEEETIELEKESKETESEKEEETIESEKESKETESEKEEETIESEKE 160 Score = 54.3 bits (129), Expect = 5e-06 Identities = 35/118 (29%), Positives = 59/118 (50%), Gaps = 6/118 (5%) Frame = -1 Query: 373 MEVEKLKPVDSFSMEVETNSNTVVMETENSKSGVIVSDAAVDCEANPTFVVS------LD 212 +E+EK +S E E T+ E E+ ++ + ++ E S ++ Sbjct: 119 IELEK----ESKETESEKEEETIESEKESKETESEKEEETIESEKESKETESKKGDKAIE 174 Query: 211 VERPSLDVETQKESEVMEVEKPSLDVGKQKESEVLEVEKPSLDVLIQKESEVSEGEKD 38 +E+ S + E++KE E ME+EK S + +KE E +E EK S + +KE E E EK+ Sbjct: 175 LEKESKETESKKEEETMELEKESKETESEKEEETIESEKESKETESEKEEETIESEKE 232 Score = 53.9 bits (128), Expect = 7e-06 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 6/109 (5%) Frame = -1 Query: 346 DSFSMEVETNSNTVVMETENSKSGVIVSDAAVDCEANPTFVVS------LDVERPSLDVE 185 +S E E T+ E E+ ++ D A++ E S +++E+ S + E Sbjct: 142 ESKETESEKEEETIESEKESKETESKKGDKAIELEKESKETESKKEEETMELEKESKETE 201 Query: 184 TQKESEVMEVEKPSLDVGKQKESEVLEVEKPSLDVLIQKESEVSEGEKD 38 ++KE E +E EK S + +KE E +E EK S + +KE E E EK+ Sbjct: 202 SEKEEETIESEKESKETESEKEEETIESEKESKETESKKEEETIESEKE 250 >WP_000795520.1 MULTISPECIES: hypothetical protein [Bacillus cereus group] EJS50751.1 hypothetical protein IC9_02674 [Bacillus cereus BAG1O-2] EJV94218.1 hypothetical protein IGI_02614 [Bacillus cereus HuB2-9] EOP27064.1 hypothetical protein IG5_02043 [Bacillus cereus HuA2-3] KMP60244.1 hypothetical protein TU60_08585 [Bacillus cereus] KNH40433.1 hypothetical protein ACS75_11785 [Bacillus thuringiensis] SCN17007.1 Uncharacterized protein BC141101_02231 [Bacillus cereus] SDK16686.1 hypothetical protein SAMN04487922_10552 [Bacillus sp. yr331] Length = 410 Score = 53.9 bits (128), Expect = 7e-06 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 6/117 (5%) Frame = -1 Query: 370 EVEKLKPVDSFSMEVETNSNTVVMETENSKSGVIVSDAAVDCEANPTFVVS------LDV 209 E+ K + ++ E E + ++ E+ K+ D A++ E S +++ Sbjct: 28 EIRKKEKIEE--TESEKEDKAIELKKESKKTESKKGDKAIELEKKSKKTESKKGDKAIEL 85 Query: 208 ERPSLDVETQKESEVMEVEKPSLDVGKQKESEVLEVEKPSLDVLIQKESEVSEGEKD 38 E+ S + E++KE E +E+EK S + +KE E +E EK S + +KE E E EK+ Sbjct: 86 EKKSKETESKKEEETIELEKESKETESEKEEETIESEKESKETESKKEEETIESEKE 142 >EEL22668.1 hypothetical protein bcere0017_26720 [Bacillus cereus Rock1-3] EEL40116.1 hypothetical protein bcere0020_26320 [Bacillus cereus Rock3-29] Length = 412 Score = 53.9 bits (128), Expect = 7e-06 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 6/117 (5%) Frame = -1 Query: 370 EVEKLKPVDSFSMEVETNSNTVVMETENSKSGVIVSDAAVDCEANPTFVVS------LDV 209 E+ K + ++ E E + ++ E+ K+ D A++ E S +++ Sbjct: 30 EIRKKEKIEE--TESEKEDKAIELKKESKKTESKKGDKAIELEKKSKKTESKKGDKAIEL 87 Query: 208 ERPSLDVETQKESEVMEVEKPSLDVGKQKESEVLEVEKPSLDVLIQKESEVSEGEKD 38 E+ S + E++KE E +E+EK S + +KE E +E EK S + +KE E E EK+ Sbjct: 88 EKKSKETESKKEEETIELEKESKETESEKEEETIESEKESKETESKKEEETIESEKE 144