BLASTX nr result
ID: Panax24_contig00023682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00023682 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009049788.1 hypothetical protein (mitochondrion) [Capsicum an... 56 4e-07 >YP_009049788.1 hypothetical protein (mitochondrion) [Capsicum annuum] AIG89832.1 hypothetical protein (mitochondrion) [Capsicum annuum] AIG90146.1 hypothetical protein (mitochondrion) [Capsicum annuum] Length = 117 Score = 55.8 bits (133), Expect = 4e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 161 KIRTFRFVSNLSLSQHIRLTSFVRSYLLHYDLPSNLY 271 K TFRFVS+ SLSQH R TSFVRS LL YDLPS+LY Sbjct: 33 KSGTFRFVSHPSLSQHFRFTSFVRSRLLRYDLPSSLY 69