BLASTX nr result
ID: Panax24_contig00023670
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00023670 (656 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN06782.1 hypothetical protein DCAR_007619 [Daucus carota subsp... 59 9e-07 XP_017235860.1 PREDICTED: beta-galactosidase [Daucus carota subs... 59 1e-06 EYU45851.1 hypothetical protein MIMGU_mgv1a002308mg [Erythranthe... 57 8e-06 XP_012835100.1 PREDICTED: LOW QUALITY PROTEIN: beta-galactosidas... 57 8e-06 >KZN06782.1 hypothetical protein DCAR_007619 [Daucus carota subsp. sativus] Length = 666 Score = 59.3 bits (142), Expect = 9e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 655 VRIDSDEALLRGGKWHILTVLYAGQALHVFINGQLT 548 VRIDSDE LRGG+W +LTVL AG ALHVFIN QLT Sbjct: 381 VRIDSDEGFLRGGEWPVLTVLSAGHALHVFINDQLT 416 >XP_017235860.1 PREDICTED: beta-galactosidase [Daucus carota subsp. sativus] Length = 835 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 655 VRIDSDEALLRGGKWHILTVLYAGQALHVFINGQLT 548 VRIDSDE LRGG+W +LTVL AG ALHVFIN QLT Sbjct: 472 VRIDSDEGFLRGGEWPVLTVLSAGHALHVFINDQLT 507 >EYU45851.1 hypothetical protein MIMGU_mgv1a002308mg [Erythranthe guttata] Length = 689 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 655 VRIDSDEALLRGGKWHILTVLYAGQALHVFINGQLT 548 VRIDS E LRGGKW +LTV AG ALHVFINGQL+ Sbjct: 326 VRIDSREGFLRGGKWPVLTVSSAGHALHVFINGQLS 361 >XP_012835100.1 PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Erythranthe guttata] Length = 784 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 655 VRIDSDEALLRGGKWHILTVLYAGQALHVFINGQLT 548 VRIDS E LRGGKW +LTV AG ALHVFINGQL+ Sbjct: 421 VRIDSREGFLRGGKWPVLTVSSAGHALHVFINGQLS 456