BLASTX nr result
ID: Panax24_contig00023570
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00023570 (677 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010270524.1 PREDICTED: MLO-like protein 9 [Nelumbo nucifera] ... 68 3e-13 KJB10418.1 hypothetical protein B456_001G200000 [Gossypium raimo... 64 9e-13 XP_007046462.1 PREDICTED: MLO-like protein 10 [Theobroma cacao] ... 64 9e-13 XP_016730723.1 PREDICTED: MLO-like protein 10 [Gossypium hirsutu... 64 9e-13 XP_012487449.1 PREDICTED: MLO-like protein 10 [Gossypium raimond... 64 9e-13 XP_017611490.1 PREDICTED: MLO-like protein 10 [Gossypium arboreu... 64 9e-13 XP_016743464.1 PREDICTED: MLO-like protein 10 [Gossypium hirsutu... 64 9e-13 XP_017229325.1 PREDICTED: MLO-like protein 10 [Daucus carota sub... 62 9e-13 KHG22053.1 MLO-like protein 8 [Gossypium arboreum] 64 9e-13 KZN08431.1 hypothetical protein DCAR_000977 [Daucus carota subsp... 62 9e-13 KJB10419.1 hypothetical protein B456_001G200000 [Gossypium raimo... 64 9e-13 KJB10416.1 hypothetical protein B456_001G200000 [Gossypium raimo... 64 9e-13 XP_010029568.1 PREDICTED: MLO-like protein 10 [Eucalyptus grandis] 65 1e-12 KCW56485.1 hypothetical protein EUGRSUZ_I02212 [Eucalyptus grandis] 65 1e-12 XP_012065427.1 PREDICTED: MLO-like protein 10 [Jatropha curcas] 62 2e-12 KDP43787.1 hypothetical protein JCGZ_22414 [Jatropha curcas] 62 2e-12 OMO83394.1 Mlo-related protein [Corchorus olitorius] 64 3e-12 OMO55669.1 Mlo-related protein [Corchorus capsularis] 64 3e-12 AHF52924.1 Mlo protein [Hevea brasiliensis] 63 3e-12 OAY61011.1 hypothetical protein MANES_01G156800 [Manihot esculenta] 63 3e-12 >XP_010270524.1 PREDICTED: MLO-like protein 9 [Nelumbo nucifera] XP_019054898.1 PREDICTED: MLO-like protein 9 [Nelumbo nucifera] Length = 561 Score = 67.8 bits (164), Expect(2) = 3e-13 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 496 NFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVII 380 + +Y H DPSRFRLTHETSFVRA T+FWTRIPFFFV + Sbjct: 185 SLNYEFHYDPSRFRLTHETSFVRAHTNFWTRIPFFFVFV 223 Score = 35.0 bits (79), Expect(2) = 3e-13 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVFH 600 LKIRGWK WE+ET S + FH Sbjct: 171 LKIRGWKAWERETQSLNYEFH 191 >KJB10418.1 hypothetical protein B456_001G200000 [Gossypium raimondii] Length = 618 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 252 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 290 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 239 LKIRGWKVWEQETLSHDYEF 258 >XP_007046462.1 PREDICTED: MLO-like protein 10 [Theobroma cacao] XP_017983398.1 PREDICTED: MLO-like protein 10 [Theobroma cacao] EOX90619.1 Seven transmembrane MLO family protein [Theobroma cacao] Length = 575 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 207 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 245 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 194 LKIRGWKVWEQETLSHDYEF 213 >XP_016730723.1 PREDICTED: MLO-like protein 10 [Gossypium hirsutum] XP_016730724.1 PREDICTED: MLO-like protein 10 [Gossypium hirsutum] XP_016730725.1 PREDICTED: MLO-like protein 10 [Gossypium hirsutum] Length = 574 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 208 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 246 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 195 LKIRGWKVWEQETLSHDYEF 214 >XP_012487449.1 PREDICTED: MLO-like protein 10 [Gossypium raimondii] XP_012487456.1 PREDICTED: MLO-like protein 10 [Gossypium raimondii] XP_012487465.1 PREDICTED: MLO-like protein 10 [Gossypium raimondii] XP_012487473.1 PREDICTED: MLO-like protein 10 [Gossypium raimondii] KJB10414.1 hypothetical protein B456_001G200000 [Gossypium raimondii] KJB10415.1 hypothetical protein B456_001G200000 [Gossypium raimondii] KJB10417.1 hypothetical protein B456_001G200000 [Gossypium raimondii] Length = 574 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 208 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 246 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 195 LKIRGWKVWEQETLSHDYEF 214 >XP_017611490.1 PREDICTED: MLO-like protein 10 [Gossypium arboreum] XP_017611499.1 PREDICTED: MLO-like protein 10 [Gossypium arboreum] XP_017611507.1 PREDICTED: MLO-like protein 10 [Gossypium arboreum] XP_017611515.1 PREDICTED: MLO-like protein 10 [Gossypium arboreum] Length = 572 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 208 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 246 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 195 LKIRGWKVWEQETLSHDYEF 214 >XP_016743464.1 PREDICTED: MLO-like protein 10 [Gossypium hirsutum] XP_016743465.1 PREDICTED: MLO-like protein 10 [Gossypium hirsutum] Length = 572 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 208 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 246 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 195 LKIRGWKVWEQETLSHDYEF 214 >XP_017229325.1 PREDICTED: MLO-like protein 10 [Daucus carota subsp. sativus] Length = 568 Score = 61.6 bits (148), Expect(2) = 9e-13 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 487 YNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 Y DPSRFRLTHETSFV+A TSFWT++PFFFV+ Sbjct: 200 YEFSNDPSRFRLTHETSFVKAHTSFWTKLPFFFVV 234 Score = 39.7 bits (91), Expect(2) = 9e-13 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQETAS D F Sbjct: 183 LKIRGWKVWEQETASHDYEF 202 >KHG22053.1 MLO-like protein 8 [Gossypium arboreum] Length = 560 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 208 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 246 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 195 LKIRGWKVWEQETLSHDYEF 214 >KZN08431.1 hypothetical protein DCAR_000977 [Daucus carota subsp. sativus] Length = 559 Score = 61.6 bits (148), Expect(2) = 9e-13 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 487 YNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 Y DPSRFRLTHETSFV+A TSFWT++PFFFV+ Sbjct: 191 YEFSNDPSRFRLTHETSFVKAHTSFWTKLPFFFVV 225 Score = 39.7 bits (91), Expect(2) = 9e-13 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQETAS D F Sbjct: 174 LKIRGWKVWEQETASHDYEF 193 >KJB10419.1 hypothetical protein B456_001G200000 [Gossypium raimondii] Length = 509 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 143 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 181 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 130 LKIRGWKVWEQETLSHDYEF 149 >KJB10416.1 hypothetical protein B456_001G200000 [Gossypium raimondii] Length = 454 Score = 63.5 bits (153), Expect(2) = 9e-13 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 208 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 246 Score = 37.7 bits (86), Expect(2) = 9e-13 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 195 LKIRGWKVWEQETLSHDYEF 214 >XP_010029568.1 PREDICTED: MLO-like protein 10 [Eucalyptus grandis] Length = 570 Score = 65.5 bits (158), Expect(2) = 1e-12 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFVRA TSFWTRIPFFF I Sbjct: 185 LSHDYEFSTDPSRFRLTHETSFVRAHTSFWTRIPFFFYI 223 Score = 35.4 bits (80), Expect(2) = 1e-12 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWK WEQET S D F Sbjct: 172 LKIRGWKQWEQETLSHDYEF 191 >KCW56485.1 hypothetical protein EUGRSUZ_I02212 [Eucalyptus grandis] Length = 569 Score = 65.5 bits (158), Expect(2) = 1e-12 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFVRA TSFWTRIPFFF I Sbjct: 185 LSHDYEFSTDPSRFRLTHETSFVRAHTSFWTRIPFFFYI 223 Score = 35.4 bits (80), Expect(2) = 1e-12 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWK WEQET S D F Sbjct: 172 LKIRGWKQWEQETLSHDYEF 191 >XP_012065427.1 PREDICTED: MLO-like protein 10 [Jatropha curcas] Length = 578 Score = 62.4 bits (150), Expect(2) = 2e-12 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSR RLTHETSFVRA TSFWTRIPFFF I Sbjct: 208 LSHDYEFSNDPSRIRLTHETSFVRAHTSFWTRIPFFFYI 246 Score = 37.7 bits (86), Expect(2) = 2e-12 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 195 LKIRGWKVWEQETLSHDYEF 214 >KDP43787.1 hypothetical protein JCGZ_22414 [Jatropha curcas] Length = 566 Score = 62.4 bits (150), Expect(2) = 2e-12 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSR RLTHETSFVRA TSFWTRIPFFF I Sbjct: 196 LSHDYEFSNDPSRIRLTHETSFVRAHTSFWTRIPFFFYI 234 Score = 37.7 bits (86), Expect(2) = 2e-12 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWEQET S D F Sbjct: 183 LKIRGWKVWEQETLSHDYEF 202 >OMO83394.1 Mlo-related protein [Corchorus olitorius] Length = 553 Score = 63.5 bits (153), Expect(2) = 3e-12 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 187 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 225 Score = 36.2 bits (82), Expect(2) = 3e-12 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWE+ET S D F Sbjct: 174 LKIRGWKVWEKETLSHDYEF 193 >OMO55669.1 Mlo-related protein [Corchorus capsularis] Length = 553 Score = 63.5 bits (153), Expect(2) = 3e-12 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 499 LNFSYNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 L+ Y DPSRFRLTHETSFV+A TSFWTRIPFFF I Sbjct: 187 LSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFFFYI 225 Score = 36.2 bits (82), Expect(2) = 3e-12 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWKVWE+ET S D F Sbjct: 174 LKIRGWKVWEKETLSHDYEF 193 >AHF52924.1 Mlo protein [Hevea brasiliensis] Length = 574 Score = 63.2 bits (152), Expect(2) = 3e-12 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -2 Query: 487 YNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 Y DPSRFRLTHETSFVRA TSFWTRIPFFF I Sbjct: 208 YEFSNDPSRFRLTHETSFVRAHTSFWTRIPFFFYI 242 Score = 36.2 bits (82), Expect(2) = 3e-12 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWK WEQET+S D F Sbjct: 191 LKIRGWKEWEQETSSHDYEF 210 >OAY61011.1 hypothetical protein MANES_01G156800 [Manihot esculenta] Length = 571 Score = 63.2 bits (152), Expect(2) = 3e-12 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -2 Query: 487 YNEHADPSRFRLTHETSFVRARTSFWTRIPFFFVI 383 Y DPSRFRLTHETSFVRA TSFWTRIPFFF I Sbjct: 206 YEFSNDPSRFRLTHETSFVRAHTSFWTRIPFFFYI 240 Score = 36.2 bits (82), Expect(2) = 3e-12 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 662 LKIRGWKVWEQETASQDRVF 603 LKIRGWK WEQET+S D F Sbjct: 189 LKIRGWKEWEQETSSHDYEF 208