BLASTX nr result
ID: Panax24_contig00023558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00023558 (1208 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN79628.1 hypothetical protein VITISV_002583 [Vitis vinifera] 61 4e-08 ERM94351.1 hypothetical protein AMTR_s00010p00245480 [Amborella ... 61 7e-07 GAV83959.1 EMP70 domain-containing protein [Cephalotus follicula... 62 1e-06 XP_019261458.1 PREDICTED: transmembrane 9 superfamily member 11-... 62 1e-06 XP_018629081.1 PREDICTED: transmembrane 9 superfamily member 11 ... 62 1e-06 XP_009775737.1 PREDICTED: transmembrane 9 superfamily member 4 [... 62 1e-06 XP_016540226.1 PREDICTED: transmembrane 9 superfamily member 11 ... 62 1e-06 XP_015061206.1 PREDICTED: transmembrane 9 superfamily member 11-... 62 1e-06 XP_006350070.1 PREDICTED: transmembrane 9 superfamily member 11-... 62 1e-06 CDP07900.1 unnamed protein product [Coffea canephora] 59 1e-06 KYP77225.1 Transmembrane 9 superfamily member 4, partial [Cajanu... 60 2e-06 AAM20600.1 putative protein [Arabidopsis thaliana] AAM91266.1 pu... 60 2e-06 XP_010244791.1 PREDICTED: transmembrane 9 superfamily member 11 ... 61 2e-06 ONK59592.1 uncharacterized protein A4U43_C08F8050 [Asparagus off... 61 2e-06 XP_018683347.1 PREDICTED: transmembrane 9 superfamily member 11-... 61 2e-06 KYP33031.1 Transmembrane 9 superfamily member 4 [Cajanus cajan] 60 2e-06 XP_006414795.1 hypothetical protein EUTSA_v10024880mg [Eutrema s... 60 3e-06 NP_198366.2 Endomembrane protein 70 protein family [Arabidopsis ... 60 3e-06 XP_002868407.1 predicted protein [Arabidopsis lyrata subsp. lyra... 60 3e-06 OMO80452.1 Nonaspanin (TM9SF) [Corchorus olitorius] 60 3e-06 >CAN79628.1 hypothetical protein VITISV_002583 [Vitis vinifera] Length = 98 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 + V+ + T RRD +Y+ELDKEAQAQMNEELSRWKLVVG Sbjct: 43 VFVIFLRTVRRDFTRYEELDKEAQAQMNEELSRWKLVVG 81 >ERM94351.1 hypothetical protein AMTR_s00010p00245480 [Amborella trichopoda] Length = 265 Score = 60.8 bits (146), Expect = 7e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 121 VLVIFLRTVRRDLTRYEELDKEAQAQMNEELSSWKLVVG 159 >GAV83959.1 EMP70 domain-containing protein [Cephalotus follicularis] Length = 656 Score = 62.0 bits (149), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL QY+ELDKEAQAQMNEELS WKLVVG Sbjct: 306 VLVIFLRTVRRDLTQYEELDKEAQAQMNEELSGWKLVVG 344 >XP_019261458.1 PREDICTED: transmembrane 9 superfamily member 11-like [Nicotiana attenuata] OIT38474.1 transmembrane 9 superfamily member 11 [Nicotiana attenuata] Length = 657 Score = 62.0 bits (149), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +YDELDKEAQAQMNEELS WKLVVG Sbjct: 307 VLVIFLRTVRRDLARYDELDKEAQAQMNEELSGWKLVVG 345 >XP_018629081.1 PREDICTED: transmembrane 9 superfamily member 11 [Nicotiana tomentosiformis] Length = 657 Score = 62.0 bits (149), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +YDELDKEAQAQMNEELS WKLVVG Sbjct: 307 VLVIFLRTVRRDLARYDELDKEAQAQMNEELSGWKLVVG 345 >XP_009775737.1 PREDICTED: transmembrane 9 superfamily member 4 [Nicotiana sylvestris] XP_016448149.1 PREDICTED: transmembrane 9 superfamily member 11-like [Nicotiana tabacum] Length = 657 Score = 62.0 bits (149), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +YDELDKEAQAQMNEELS WKLVVG Sbjct: 307 VLVIFLRTVRRDLARYDELDKEAQAQMNEELSGWKLVVG 345 >XP_016540226.1 PREDICTED: transmembrane 9 superfamily member 11 [Capsicum annuum] Length = 657 Score = 61.6 bits (148), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +YDELDKEAQAQMNEELS WKLVVG Sbjct: 307 VLVIFLRTIRRDLARYDELDKEAQAQMNEELSGWKLVVG 345 >XP_015061206.1 PREDICTED: transmembrane 9 superfamily member 11-like [Solanum pennellii] XP_019067034.1 PREDICTED: transmembrane 9 superfamily member 11-like [Solanum lycopersicum] Length = 657 Score = 61.6 bits (148), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +YDELDKEAQAQMNEELS WKLVVG Sbjct: 307 VLVIFLRTIRRDLARYDELDKEAQAQMNEELSGWKLVVG 345 >XP_006350070.1 PREDICTED: transmembrane 9 superfamily member 11-like [Solanum tuberosum] Length = 657 Score = 61.6 bits (148), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +YDELDKEAQAQMNEELS WKLVVG Sbjct: 307 VLVIFLRTIRRDLARYDELDKEAQAQMNEELSGWKLVVG 345 >CDP07900.1 unnamed protein product [Coffea canephora] Length = 179 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 + V+ + T +RDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 25 VFVIFLRTVKRDLTRYEELDKEAQAQMNEELSGWKLVVG 63 >KYP77225.1 Transmembrane 9 superfamily member 4, partial [Cajanus cajan] Length = 379 Score = 60.5 bits (145), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 186 VLVIFLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 224 >AAM20600.1 putative protein [Arabidopsis thaliana] AAM91266.1 putative protein [Arabidopsis thaliana] Length = 425 Score = 60.5 bits (145), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 75 VLVIFLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 113 >XP_010244791.1 PREDICTED: transmembrane 9 superfamily member 11 [Nelumbo nucifera] Length = 657 Score = 60.8 bits (146), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 307 VLVILLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 345 >ONK59592.1 uncharacterized protein A4U43_C08F8050 [Asparagus officinalis] Length = 659 Score = 60.8 bits (146), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 309 VLVILLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 347 >XP_018683347.1 PREDICTED: transmembrane 9 superfamily member 11-like [Musa acuminata subsp. malaccensis] XP_018683348.1 PREDICTED: transmembrane 9 superfamily member 11-like [Musa acuminata subsp. malaccensis] Length = 667 Score = 60.8 bits (146), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 317 VLVILLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 355 >KYP33031.1 Transmembrane 9 superfamily member 4 [Cajanus cajan] Length = 453 Score = 60.5 bits (145), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 310 VLVIFLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 348 >XP_006414795.1 hypothetical protein EUTSA_v10024880mg [Eutrema salsugineum] XP_006414796.1 hypothetical protein EUTSA_v10024880mg [Eutrema salsugineum] ESQ56248.1 hypothetical protein EUTSA_v10024880mg [Eutrema salsugineum] ESQ56249.1 hypothetical protein EUTSA_v10024880mg [Eutrema salsugineum] Length = 535 Score = 60.5 bits (145), Expect = 3e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 185 VLVIFLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 223 >NP_198366.2 Endomembrane protein 70 protein family [Arabidopsis thaliana] AED93934.1 Endomembrane protein 70 protein family [Arabidopsis thaliana] Length = 630 Score = 60.5 bits (145), Expect = 3e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 280 VLVIFLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 318 >XP_002868407.1 predicted protein [Arabidopsis lyrata subsp. lyrata] EFH44666.1 predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 630 Score = 60.5 bits (145), Expect = 3e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 280 VLVIFLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 318 >OMO80452.1 Nonaspanin (TM9SF) [Corchorus olitorius] Length = 653 Score = 60.5 bits (145), Expect = 3e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 604 MIVVTIVTARRDLIQYDELDKEAQAQMNEELSRWKLVVG 720 ++V+ + T RRDL +Y+ELDKEAQAQMNEELS WKLVVG Sbjct: 303 VLVIFLRTVRRDLTRYEELDKEAQAQMNEELSGWKLVVG 341