BLASTX nr result
ID: Panax24_contig00023554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00023554 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM98712.1 hypothetical protein DCAR_013926 [Daucus carota subsp... 62 2e-08 XP_017247484.1 PREDICTED: Niemann-Pick C1 protein-like [Daucus c... 60 5e-08 XP_011465571.1 PREDICTED: Niemann-Pick C1 protein-like [Fragaria... 57 8e-07 XP_015884120.1 PREDICTED: Niemann-Pick C1 protein-like [Ziziphus... 56 2e-06 XP_009365689.1 PREDICTED: Niemann-Pick C1 protein-like [Pyrus x ... 56 2e-06 EOY15280.1 Patched family protein isoform 17 [Theobroma cacao] 55 4e-06 EOY15266.1 Hedgehog receptor, putative isoform 3 [Theobroma cacao] 55 4e-06 EOY15275.1 Patched family protein isoform 12 [Theobroma cacao] E... 55 4e-06 KJB14244.1 hypothetical protein B456_002G115700 [Gossypium raimo... 55 4e-06 EOY15271.1 Hedgehog receptor, putative isoform 8 [Theobroma cacao] 55 4e-06 EOY15270.1 Hedgehog receptor, putative isoform 7 [Theobroma caca... 55 4e-06 EOY15279.1 Patched family protein isoform 16 [Theobroma cacao] 55 4e-06 EOY15273.1 Hedgehog receptor, putative isoform 10 [Theobroma cacao] 55 4e-06 EOY15274.1 Hedgehog receptor, putative isoform 11 [Theobroma cacao] 55 4e-06 EOY15272.1 Hedgehog receptor, putative isoform 9 [Theobroma cacao] 55 4e-06 EOY15267.1 Hedgehog receptor, putative isoform 4 [Theobroma cacao] 55 4e-06 XP_016702902.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypiu... 55 4e-06 XP_012464596.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypiu... 55 4e-06 XP_017642001.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypiu... 55 4e-06 XP_007018039.2 PREDICTED: Niemann-Pick C1 protein [Theobroma cacao] 55 4e-06 >KZM98712.1 hypothetical protein DCAR_013926 [Daucus carota subsp. sativus] Length = 1276 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKKNQD 8 +LI+ATKPD EHGKSP IVTE+NIKLLFEIQKK D Sbjct: 399 QLIIATKPDPEHGKSPKIVTENNIKLLFEIQKKVSD 434 >XP_017247484.1 PREDICTED: Niemann-Pick C1 protein-like [Daucus carota subsp. sativus] Length = 1299 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LI+ATKPD EHGKSP IVTE+NIKLLFEIQKK Sbjct: 444 QLIIATKPDPEHGKSPKIVTENNIKLLFEIQKK 476 >XP_011465571.1 PREDICTED: Niemann-Pick C1 protein-like [Fragaria vesca subsp. vesca] Length = 1284 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LI+AT PD +HGK+P+IVTEDNIKLLFEI+KK Sbjct: 430 QLIIATMPDVKHGKAPSIVTEDNIKLLFEIEKK 462 >XP_015884120.1 PREDICTED: Niemann-Pick C1 protein-like [Ziziphus jujuba] Length = 1285 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +L+LAT PD HGKSP+IVTE+NIKLLFEIQKK Sbjct: 432 QLVLATIPDQSHGKSPSIVTENNIKLLFEIQKK 464 >XP_009365689.1 PREDICTED: Niemann-Pick C1 protein-like [Pyrus x bretschneideri] Length = 1289 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT P+ +HG SP+IVTEDNIKLLFEIQKK Sbjct: 435 QLILATIPEGKHGNSPSIVTEDNIKLLFEIQKK 467 >EOY15280.1 Patched family protein isoform 17 [Theobroma cacao] Length = 914 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >EOY15266.1 Hedgehog receptor, putative isoform 3 [Theobroma cacao] Length = 1078 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >EOY15275.1 Patched family protein isoform 12 [Theobroma cacao] EOY15276.1 Patched family protein isoform 12 [Theobroma cacao] EOY15277.1 Patched family protein isoform 12 [Theobroma cacao] Length = 1107 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >KJB14244.1 hypothetical protein B456_002G115700 [Gossypium raimondii] Length = 1123 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA +GKSP+IVTE+NIKLLFEIQKK Sbjct: 433 QLILATIPDALNGKSPSIVTEENIKLLFEIQKK 465 >EOY15271.1 Hedgehog receptor, putative isoform 8 [Theobroma cacao] Length = 1124 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >EOY15270.1 Hedgehog receptor, putative isoform 7 [Theobroma cacao] EOY15278.1 Hedgehog receptor, putative isoform 7 [Theobroma cacao] Length = 1139 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >EOY15279.1 Patched family protein isoform 16 [Theobroma cacao] Length = 1187 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >EOY15273.1 Hedgehog receptor, putative isoform 10 [Theobroma cacao] Length = 1200 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >EOY15274.1 Hedgehog receptor, putative isoform 11 [Theobroma cacao] Length = 1235 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >EOY15272.1 Hedgehog receptor, putative isoform 9 [Theobroma cacao] Length = 1250 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >EOY15267.1 Hedgehog receptor, putative isoform 4 [Theobroma cacao] Length = 1274 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466 >XP_016702902.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypium hirsutum] Length = 1287 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA +GKSP+IVTE+NIKLLFEIQKK Sbjct: 433 QLILATIPDALNGKSPSIVTEENIKLLFEIQKK 465 >XP_012464596.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypium raimondii] KJB14243.1 hypothetical protein B456_002G115700 [Gossypium raimondii] Length = 1287 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA +GKSP+IVTE+NIKLLFEIQKK Sbjct: 433 QLILATIPDALNGKSPSIVTEENIKLLFEIQKK 465 >XP_017642001.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypium arboreum] KHG02724.1 Niemann-Pick C1 [Gossypium arboreum] Length = 1287 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA +GKSP+IVTE+NIKLLFEIQKK Sbjct: 433 QLILATIPDALNGKSPSIVTEENIKLLFEIQKK 465 >XP_007018039.2 PREDICTED: Niemann-Pick C1 protein [Theobroma cacao] Length = 1288 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 115 ELILATKPDAEHGKSPNIVTEDNIKLLFEIQKK 17 +LILAT PDA H KSP+IVTE+NIKLLFEIQKK Sbjct: 434 QLILATIPDALHDKSPSIVTEENIKLLFEIQKK 466