BLASTX nr result
ID: Panax24_contig00022980
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022980 (590 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV73287.1 hypothetical protein CFOL_v3_16773 [Cephalotus follic... 78 2e-15 KYP38617.1 Retrovirus-related Pol polyprotein from transposon TN... 68 2e-10 GAV72193.1 hypothetical protein CFOL_v3_15682 [Cephalotus follic... 62 3e-08 >GAV73287.1 hypothetical protein CFOL_v3_16773 [Cephalotus follicularis] Length = 105 Score = 78.2 bits (191), Expect = 2e-15 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = +2 Query: 386 KRVDIKGVENVRFKLYDNSVKNLEKVCYVSSCGENIISLGELSSHGYTFVGQGDSCKVFK 565 +RV I+GV +VRFKL+ + +K L +V Y C NII +L+S GY++ GQGD CKV+K Sbjct: 35 ERVKIEGVGSVRFKLHTDDIKTLRRVNYEPKCSANIILWRDLASRGYSYRGQGDWCKVYK 94 Query: 566 EDKLILQG 589 +DKLILQG Sbjct: 95 QDKLILQG 102 >KYP38617.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 273 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/68 (45%), Positives = 46/68 (67%) Frame = +2 Query: 386 KRVDIKGVENVRFKLYDNSVKNLEKVCYVSSCGENIISLGELSSHGYTFVGQGDSCKVFK 565 +++++K + VR KL++ +++ E V YV S NIISLGEL+S Y +V CKV+K Sbjct: 189 RKMEVKSIGTVRMKLHNGAIQTFENVRYVPSAASNIISLGELTSQDYRYVSSKWGCKVYK 248 Query: 566 EDKLILQG 589 E +LILQG Sbjct: 249 EKRLILQG 256 >GAV72193.1 hypothetical protein CFOL_v3_15682 [Cephalotus follicularis] Length = 242 Score = 62.0 bits (149), Expect = 3e-08 Identities = 31/68 (45%), Positives = 45/68 (66%) Frame = +2 Query: 386 KRVDIKGVENVRFKLYDNSVKNLEKVCYVSSCGENIISLGELSSHGYTFVGQGDSCKVFK 565 +++ I+ + VR KL+D VK ++ + YV +ISL EL+S YT+VG+ D CKV+K Sbjct: 51 EKMKIESIGCVRLKLHDGVVKTIQHMRYVLKFDYYVISLRELASRAYTYVGKRDWCKVYK 110 Query: 566 EDKLILQG 589 D LILQG Sbjct: 111 NDVLILQG 118