BLASTX nr result
ID: Panax24_contig00022867
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022867 (440 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222255.1 PREDICTED: scarecrow-like protein 18 [Daucus caro... 58 6e-07 >XP_017222255.1 PREDICTED: scarecrow-like protein 18 [Daucus carota subsp. sativus] KZM85573.1 hypothetical protein DCAR_027005 [Daucus carota subsp. sativus] Length = 579 Score = 57.8 bits (138), Expect = 6e-07 Identities = 30/47 (63%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = +2 Query: 2 GKKLMSVAHSLNLSFSFNVVMVADMLDLNETLSELNS--NCSVFQDC 136 GK+L+SVA SLNLSFSFNVVMVADMLD NE+ +L++ C+V+ C Sbjct: 368 GKRLISVAQSLNLSFSFNVVMVADMLDHNESHFKLDTKETCAVYAPC 414