BLASTX nr result
ID: Panax24_contig00022727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022727 (483 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228540.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 100 1e-21 XP_017228534.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 100 1e-21 KZN10387.1 hypothetical protein DCAR_003043 [Daucus carota subsp... 100 1e-21 XP_010648639.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 99 4e-21 XP_010648638.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 99 4e-21 XP_002285000.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 99 4e-21 KVH99795.1 Cyclophilin-like peptidyl-prolyl cis-trans isomerase ... 93 4e-19 XP_015084937.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 92 1e-18 XP_010325121.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 92 1e-18 XP_019070745.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 92 1e-18 XP_015084936.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 92 1e-18 XP_010325122.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 92 1e-18 XP_015084935.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 92 1e-18 XP_015084934.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 92 1e-18 XP_004245196.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 92 1e-18 XP_017184879.1 PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl c... 90 4e-18 XP_011084184.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 90 5e-18 XP_018498159.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 90 5e-18 XP_009334770.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 90 5e-18 XP_009334769.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 90 5e-18 >XP_017228540.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Daucus carota subsp. sativus] Length = 649 Score = 100 bits (249), Expect = 1e-21 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 N+RRS SRSPVG GRRARSPYADR RSISRSPSPDGS KRIRRGRGFSQRYS ARR Sbjct: 452 NSRRSYSRSPVGYGRRARSPYADRARSISRSPSPDGSTKRIRRGRGFSQRYSTARR 507 >XP_017228534.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Daucus carota subsp. sativus] Length = 758 Score = 100 bits (249), Expect = 1e-21 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 N+RRS SRSPVG GRRARSPYADR RSISRSPSPDGS KRIRRGRGFSQRYS ARR Sbjct: 561 NSRRSYSRSPVGYGRRARSPYADRARSISRSPSPDGSTKRIRRGRGFSQRYSTARR 616 >KZN10387.1 hypothetical protein DCAR_003043 [Daucus carota subsp. sativus] Length = 766 Score = 100 bits (249), Expect = 1e-21 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 N+RRS SRSPVG GRRARSPYADR RSISRSPSPDGS KRIRRGRGFSQRYS ARR Sbjct: 569 NSRRSYSRSPVGYGRRARSPYADRARSISRSPSPDGSTKRIRRGRGFSQRYSTARR 624 >XP_010648639.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Vitis vinifera] Length = 686 Score = 99.0 bits (245), Expect = 4e-21 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSP +GRRARSP +DR R++SRSPSPDGSPKRIRRGRGFS+RYSYARR Sbjct: 478 NNRRSYSRSPASSGRRARSPASDRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARR 533 >XP_010648638.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Vitis vinifera] Length = 795 Score = 99.0 bits (245), Expect = 4e-21 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSP +GRRARSP +DR R++SRSPSPDGSPKRIRRGRGFS+RYSYARR Sbjct: 587 NNRRSYSRSPASSGRRARSPASDRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARR 642 >XP_002285000.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Vitis vinifera] XP_010648637.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Vitis vinifera] Length = 796 Score = 99.0 bits (245), Expect = 4e-21 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSP +GRRARSP +DR R++SRSPSPDGSPKRIRRGRGFS+RYSYARR Sbjct: 588 NNRRSYSRSPASSGRRARSPASDRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARR 643 >KVH99795.1 Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 847 Score = 93.2 bits (230), Expect = 4e-19 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 ++RRS SRSPVG GRRARSP DRGRS+SRS SPDGSPKRIRRGRGFS RYSYARR Sbjct: 639 SSRRSYSRSPVG-GRRARSPLGDRGRSLSRSASPDGSPKRIRRGRGFSNRYSYARR 693 >XP_015084937.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Solanum pennellii] Length = 698 Score = 92.0 bits (227), Expect = 1e-18 Identities = 46/56 (82%), Positives = 47/56 (83%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSPV AGRRARSP DR RS SRS S DGSPKRIRRGRGFS+RYSY RR Sbjct: 501 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 556 >XP_010325121.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Solanum lycopersicum] XP_019070746.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Solanum lycopersicum] Length = 698 Score = 92.0 bits (227), Expect = 1e-18 Identities = 46/56 (82%), Positives = 47/56 (83%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSPV AGRRARSP DR RS SRS S DGSPKRIRRGRGFS+RYSY RR Sbjct: 501 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 556 >XP_019070745.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Solanum lycopersicum] Length = 731 Score = 92.0 bits (227), Expect = 1e-18 Identities = 46/56 (82%), Positives = 47/56 (83%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSPV AGRRARSP DR RS SRS S DGSPKRIRRGRGFS+RYSY RR Sbjct: 534 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 589 >XP_015084936.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Solanum pennellii] Length = 731 Score = 92.0 bits (227), Expect = 1e-18 Identities = 46/56 (82%), Positives = 47/56 (83%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSPV AGRRARSP DR RS SRS S DGSPKRIRRGRGFS+RYSY RR Sbjct: 534 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 589 >XP_010325122.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Solanum lycopersicum] Length = 746 Score = 92.0 bits (227), Expect = 1e-18 Identities = 46/56 (82%), Positives = 47/56 (83%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSPV AGRRARSP DR RS SRS S DGSPKRIRRGRGFS+RYSY RR Sbjct: 549 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 604 >XP_015084935.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Solanum pennellii] Length = 754 Score = 92.0 bits (227), Expect = 1e-18 Identities = 46/56 (82%), Positives = 47/56 (83%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSPV AGRRARSP DR RS SRS S DGSPKRIRRGRGFS+RYSY RR Sbjct: 557 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 612 >XP_015084934.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Solanum pennellii] Length = 807 Score = 92.0 bits (227), Expect = 1e-18 Identities = 46/56 (82%), Positives = 47/56 (83%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSPV AGRRARSP DR RS SRS S DGSPKRIRRGRGFS+RYSY RR Sbjct: 610 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 665 >XP_004245196.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Solanum lycopersicum] Length = 807 Score = 92.0 bits (227), Expect = 1e-18 Identities = 46/56 (82%), Positives = 47/56 (83%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSPV AGRRARSP DR RS SRS S DGSPKRIRRGRGFS+RYSY RR Sbjct: 610 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 665 >XP_017184879.1 PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase CYP95-like [Malus domestica] Length = 496 Score = 90.1 bits (222), Expect = 4e-18 Identities = 46/57 (80%), Positives = 48/57 (84%), Gaps = 1/57 (1%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYA-DRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSP RR RSP + DRGRS+SRS SPDGSPKRIRRGRGFSQRYSYARR Sbjct: 283 NNRRSYSRSPSPVARRVRSPISPDRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARR 339 >XP_011084184.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum indicum] XP_011084254.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum indicum] XP_011084337.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum indicum] Length = 784 Score = 90.1 bits (222), Expect = 5e-18 Identities = 45/55 (81%), Positives = 46/55 (83%) Frame = -2 Query: 167 NRRSISRSPVGAGRRARSPYADRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NR S S SPV AGRRARSP +DRGRS SRSPS DGSPKRIRRGRGFS RYSY RR Sbjct: 577 NRPSYSGSPVSAGRRARSPVSDRGRSSSRSPSVDGSPKRIRRGRGFSDRYSYVRR 631 >XP_018498159.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X3 [Pyrus x bretschneideri] Length = 833 Score = 90.1 bits (222), Expect = 5e-18 Identities = 46/57 (80%), Positives = 48/57 (84%), Gaps = 1/57 (1%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYA-DRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSP RR RSP + DRGRS+SRS SPDGSPKRIRRGRGFSQRYSYARR Sbjct: 622 NNRRSYSRSPSPVARRVRSPMSPDRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARR 678 >XP_009334770.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X2 [Pyrus x bretschneideri] Length = 846 Score = 90.1 bits (222), Expect = 5e-18 Identities = 46/57 (80%), Positives = 48/57 (84%), Gaps = 1/57 (1%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYA-DRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSP RR RSP + DRGRS+SRS SPDGSPKRIRRGRGFSQRYSYARR Sbjct: 635 NNRRSYSRSPSPVARRVRSPMSPDRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARR 691 >XP_009334769.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Pyrus x bretschneideri] XP_018498158.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Pyrus x bretschneideri] Length = 854 Score = 90.1 bits (222), Expect = 5e-18 Identities = 46/57 (80%), Positives = 48/57 (84%), Gaps = 1/57 (1%) Frame = -2 Query: 170 NNRRSISRSPVGAGRRARSPYA-DRGRSISRSPSPDGSPKRIRRGRGFSQRYSYARR 3 NNRRS SRSP RR RSP + DRGRS+SRS SPDGSPKRIRRGRGFSQRYSYARR Sbjct: 643 NNRRSYSRSPSPVARRVRSPMSPDRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARR 699