BLASTX nr result
ID: Panax24_contig00022697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022697 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP19576.1 unnamed protein product [Coffea canephora] 67 2e-10 XP_018823780.1 PREDICTED: uncharacterized protein LOC108993349 [... 66 4e-10 XP_018718740.1 PREDICTED: uncharacterized protein LOC104418976 i... 64 2e-09 XP_010028764.1 PREDICTED: uncharacterized protein LOC104418976 i... 64 2e-09 XP_010646714.1 PREDICTED: uncharacterized protein LOC100248653 [... 64 2e-09 CBI37848.3 unnamed protein product, partial [Vitis vinifera] 64 2e-09 XP_016441828.1 PREDICTED: translation initiation factor IF-3-lik... 60 5e-09 GAV57555.1 IF3_C domain-containing protein/IF3_N domain-containi... 62 1e-08 CAN79141.1 hypothetical protein VITISV_023967 [Vitis vinifera] 61 2e-08 XP_015062877.1 PREDICTED: uncharacterized protein LOC107008380 [... 61 2e-08 XP_004231055.1 PREDICTED: uncharacterized protein LOC101244815 [... 61 2e-08 XP_009797420.1 PREDICTED: uncharacterized protein LOC104243855 [... 60 3e-08 XP_009628269.1 PREDICTED: uncharacterized protein LOC104118676 [... 60 3e-08 XP_019230775.1 PREDICTED: uncharacterized protein LOC109211667 [... 60 3e-08 XP_008809451.2 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 60 3e-08 XP_018682353.1 PREDICTED: uncharacterized protein LOC103987098 i... 60 3e-08 XP_009403570.1 PREDICTED: uncharacterized protein LOC103987098 i... 60 3e-08 XP_018682352.1 PREDICTED: uncharacterized protein LOC103987098 i... 60 3e-08 XP_011649302.1 PREDICTED: uncharacterized protein LOC101207030 i... 60 4e-08 XP_008457719.1 PREDICTED: uncharacterized protein LOC103497345 i... 60 4e-08 >CDP19576.1 unnamed protein product [Coffea canephora] Length = 500 Score = 66.6 bits (161), Expect = 2e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV RN KPPVCKLMDY++EKYK++L+EK+RSK+R Sbjct: 116 LDLVEVQRNAKPPVCKLMDYYKEKYKKELQEKERSKQR 153 >XP_018823780.1 PREDICTED: uncharacterized protein LOC108993349 [Juglans regia] Length = 563 Score = 65.9 bits (159), Expect = 4e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV RN PPVC+LMD+HREKYKQQL+EKDR+K + Sbjct: 118 LDLVEVQRNADPPVCRLMDFHREKYKQQLKEKDRAKTK 155 >XP_018718740.1 PREDICTED: uncharacterized protein LOC104418976 isoform X2 [Eucalyptus grandis] KCW55581.1 hypothetical protein EUGRSUZ_I01451 [Eucalyptus grandis] Length = 437 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV ++ PPVCK+MD+HREKYKQQL+EKDR+K + Sbjct: 119 LDLVEVQKSANPPVCKIMDFHREKYKQQLKEKDRAKSQ 156 >XP_010028764.1 PREDICTED: uncharacterized protein LOC104418976 isoform X1 [Eucalyptus grandis] Length = 453 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV ++ PPVCK+MD+HREKYKQQL+EKDR+K + Sbjct: 119 LDLVEVQKSANPPVCKIMDFHREKYKQQLKEKDRAKSQ 156 >XP_010646714.1 PREDICTED: uncharacterized protein LOC100248653 [Vitis vinifera] Length = 676 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV R PPVCK+MD+HREKYKQQ++EKDR+K + Sbjct: 120 LDLVEVQRKADPPVCKIMDFHREKYKQQIKEKDRTKSK 157 >CBI37848.3 unnamed protein product, partial [Vitis vinifera] Length = 759 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV R PPVCK+MD+HREKYKQQ++EKDR+K + Sbjct: 120 LDLVEVQRKADPPVCKIMDFHREKYKQQIKEKDRTKSK 157 >XP_016441828.1 PREDICTED: translation initiation factor IF-3-like [Nicotiana tabacum] Length = 166 Score = 60.5 bits (145), Expect = 5e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKK 247 LDLVEV+RN KPPVCK+MDYH+EKY+QQL KD +KK Sbjct: 120 LDLVEVSRNAKPPVCKIMDYHKEKYQQQL--KDNAKK 154 >GAV57555.1 IF3_C domain-containing protein/IF3_N domain-containing protein [Cephalotus follicularis] Length = 662 Score = 61.6 bits (148), Expect = 1e-08 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV RN PPVCK+MD+H+EKYKQQ+++K+R+K + Sbjct: 210 LDLVEVQRNADPPVCKIMDFHKEKYKQQVKDKERAKSK 247 >CAN79141.1 hypothetical protein VITISV_023967 [Vitis vinifera] Length = 713 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV R PPVCK+MD+H EKYKQQ++EKDR+K + Sbjct: 120 LDLVEVQRKADPPVCKIMDFHXEKYKQQIKEKDRTKSK 157 >XP_015062877.1 PREDICTED: uncharacterized protein LOC107008380 [Solanum pennellii] Length = 522 Score = 60.8 bits (146), Expect = 2e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKK 247 LDLVEVARN KPPVC++MDYH+EKY+QQ++E + K Sbjct: 120 LDLVEVARNSKPPVCRIMDYHKEKYQQQVKESAKKSK 156 >XP_004231055.1 PREDICTED: uncharacterized protein LOC101244815 [Solanum lycopersicum] Length = 522 Score = 60.8 bits (146), Expect = 2e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKK 247 LDLVEVARN KPPVC++MDYH+EKY+QQ++E + K Sbjct: 120 LDLVEVARNSKPPVCRIMDYHKEKYQQQVKESAKKSK 156 >XP_009797420.1 PREDICTED: uncharacterized protein LOC104243855 [Nicotiana sylvestris] Length = 546 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKK 247 LDLVEV+RN KPPVCK+MDYH+EKY+QQL KD +KK Sbjct: 120 LDLVEVSRNAKPPVCKIMDYHKEKYQQQL--KDNAKK 154 >XP_009628269.1 PREDICTED: uncharacterized protein LOC104118676 [Nicotiana tomentosiformis] XP_009628270.1 PREDICTED: uncharacterized protein LOC104118676 [Nicotiana tomentosiformis] XP_016492793.1 PREDICTED: uncharacterized protein LOC107812250 [Nicotiana tabacum] XP_016492794.1 PREDICTED: uncharacterized protein LOC107812250 [Nicotiana tabacum] Length = 552 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKK 247 LDLVEV+RN KPPVCK+MDYH+EKY+QQL KD +KK Sbjct: 120 LDLVEVSRNAKPPVCKIMDYHKEKYQQQL--KDNAKK 154 >XP_019230775.1 PREDICTED: uncharacterized protein LOC109211667 [Nicotiana attenuata] OIT29196.1 hypothetical protein A4A49_16827 [Nicotiana attenuata] Length = 554 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKK 247 LDLVEV+RN KPPVCK+MDYH+EKY+QQL KD +KK Sbjct: 120 LDLVEVSRNAKPPVCKIMDYHKEKYQQQL--KDNAKK 154 >XP_008809451.2 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103721155, partial [Phoenix dactylifera] Length = 646 Score = 60.5 bits (145), Expect = 3e-08 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV R PPVCK+MD+HREKYKQ+++EK+R+K + Sbjct: 127 LDLVEVQRTANPPVCKIMDFHREKYKQEVKEKERAKTK 164 >XP_018682353.1 PREDICTED: uncharacterized protein LOC103987098 isoform X3 [Musa acuminata subsp. malaccensis] Length = 703 Score = 60.5 bits (145), Expect = 3e-08 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV RN PPVCK+MD+H+EK+KQ+++EK+R+K + Sbjct: 229 LDLVEVQRNANPPVCKIMDFHKEKFKQEVKEKERAKSK 266 >XP_009403570.1 PREDICTED: uncharacterized protein LOC103987098 isoform X2 [Musa acuminata subsp. malaccensis] Length = 723 Score = 60.5 bits (145), Expect = 3e-08 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV RN PPVCK+MD+H+EK+KQ+++EK+R+K + Sbjct: 226 LDLVEVQRNANPPVCKIMDFHKEKFKQEVKEKERAKSK 263 >XP_018682352.1 PREDICTED: uncharacterized protein LOC103987098 isoform X1 [Musa acuminata subsp. malaccensis] Length = 726 Score = 60.5 bits (145), Expect = 3e-08 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV RN PPVCK+MD+H+EK+KQ+++EK+R+K + Sbjct: 229 LDLVEVQRNANPPVCKIMDFHKEKFKQEVKEKERAKSK 266 >XP_011649302.1 PREDICTED: uncharacterized protein LOC101207030 isoform X2 [Cucumis sativus] Length = 503 Score = 60.1 bits (144), Expect = 4e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV + PPVCKLMD+HREKYK+Q+ EKDR K + Sbjct: 55 LDLVEVQQKANPPVCKLMDFHREKYKKQIREKDRVKSK 92 >XP_008457719.1 PREDICTED: uncharacterized protein LOC103497345 isoform X2 [Cucumis melo] Length = 508 Score = 60.1 bits (144), Expect = 4e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 357 LDLVEVARNDKPPVCKLMDYHREKYKQQLEEKDRSKKR 244 LDLVEV + PPVCKLMD+HREKYK+Q+ EKDR K + Sbjct: 55 LDLVEVQQKANPPVCKLMDFHREKYKKQIREKDRVKSK 92