BLASTX nr result
ID: Panax24_contig00022667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022667 (493 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM85506.1 hypothetical protein DCAR_027072 [Daucus carota subsp... 55 9e-06 XP_017223142.1 PREDICTED: ABC transporter C family member 14-lik... 55 9e-06 >KZM85506.1 hypothetical protein DCAR_027072 [Daucus carota subsp. sativus] Length = 1351 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 492 KEYDTPSVLLERPSIFATLVQEYSNRSSGL 403 KEYD PS LLERPS+FA LVQEYSNRSSGL Sbjct: 1322 KEYDAPSELLERPSLFAALVQEYSNRSSGL 1351 >XP_017223142.1 PREDICTED: ABC transporter C family member 14-like [Daucus carota subsp. sativus] Length = 1500 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 492 KEYDTPSVLLERPSIFATLVQEYSNRSSGL 403 KEYD PS LLERPS+FA LVQEYSNRSSGL Sbjct: 1471 KEYDAPSELLERPSLFAALVQEYSNRSSGL 1500