BLASTX nr result
ID: Panax24_contig00022450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022450 (448 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_087023.1 ribosomal protein S15 [Panax ginseng] Q68RU9.1 RecNa... 177 2e-55 YP_009121231.1 ribosomal protein S15 (chloroplast) [Panax notogi... 176 6e-55 YP_009191911.1 ribosomal protein S15 (chloroplast) [Panax japoni... 174 3e-54 YP_009266576.1 ribosomal protein S15 (chloroplast) [Panax stipul... 174 4e-54 YP_008814914.1 ribosomal protein S15 (chloroplast) [Aralia undul... 172 3e-53 YP_008815088.1 ribosomal protein S15 (chloroplast) [Metapanax de... 169 3e-52 YP_008815001.1 ribosomal protein S15 (chloroplast) [Brassaiopsis... 169 3e-52 YP_008815175.1 ribosomal protein S15 (chloroplast) [Schefflera d... 168 1e-51 YP_004935610.1 ribosomal protein S15 (chloroplast) [Eleutherococ... 168 1e-51 YP_009338480.1 ribosomal protein S15 (chloroplast) [Pterygopleur... 167 3e-51 AKZ24289.1 ribosomal protein S15 (plastid) [Cicuta maculata] 166 8e-51 YP_009331746.1 ribosomal protein S15 (chloroplast) [Arracacia xa... 164 2e-50 YP_009186310.1 ribosomal protein S15 (chloroplast) [Ostericum gr... 164 3e-50 YP_009155269.1 ribosomal protein S15 (plastid) [Pastinaca pimpin... 164 4e-50 ALN96868.1 ribosomal protein S15 (chloroplast) [Angelica decursiva] 164 5e-50 YP_009235937.1 ribosomal protein S15 (chloroplast) [Foeniculum v... 162 1e-49 ANS72171.1 ribosomal protein S15 (chloroplast) [Ledebouriella se... 162 2e-49 ANS72088.1 ribosomal protein S15 (chloroplast) [Glehnia littoralis] 162 3e-49 YP_009338313.1 ribosomal protein S15 (chloroplast) [Pleurospermu... 161 4e-49 YP_004222703.1 ribosomal protein S15 (chloroplast) [Anthriscus c... 161 4e-49 >YP_087023.1 ribosomal protein S15 [Panax ginseng] Q68RU9.1 RecName: Full=30S ribosomal protein S15, chloroplastic AAT98567.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AGM15021.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AGM15107.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AGM15193.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AGW31953.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX97946.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX98031.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX98116.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX98201.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX98286.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX98371.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX98456.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX98541.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AIX98627.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AJC99630.1 ribosomal protein S15 (chloroplast) [Panax ginseng] AJC99715.1 ribosomal protein S15 (chloroplast) [Panax ginseng] Length = 90 Score = 177 bits (449), Expect = 2e-55 Identities = 90/90 (100%), Positives = 90/90 (100%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETKIR Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 90 >YP_009121231.1 ribosomal protein S15 (chloroplast) [Panax notoginseng] YP_009155485.1 ribosomal protein S15 (chloroplast) [Panax quinquefolius] YP_009191998.1 ribosomal protein S15 (chloroplast) [Panax vietnamensis] AIA24385.1 ribosomal protein S15 (chloroplast) [Panax notoginseng] AJC99545.1 ribosomal protein S15 (chloroplast) [Panax quinquefolius] AKB99130.1 ribosomal protein S15 (chloroplast) [Panax notoginseng] AKB99304.1 ribosomal protein S15 (chloroplast) [Panax vietnamensis] AKB99391.1 ribosomal protein S15 (chloroplast) [Panax vietnamensis] AKG26658.1 ribosomal protein S15 (chloroplast) [Panax notoginseng] AKU70835.1 ribosomal protein S15 (chloroplast) [Panax notoginseng] AKZ29805.1 ribosomal protein S15 (chloroplast) [Panax quinquefolius] AMR97506.1 ribosomal protein S15 (chloroplast) [Panax vietnamensis] Length = 90 Score = 176 bits (446), Expect = 6e-55 Identities = 89/90 (98%), Positives = 90/90 (100%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFSGIILKEENKDN+GSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSGIILKEENKDNKGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETKIR Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 90 >YP_009191911.1 ribosomal protein S15 (chloroplast) [Panax japonicus] AKB99217.1 ribosomal protein S15 (chloroplast) [Panax japonicus] Length = 90 Score = 174 bits (442), Expect = 3e-54 Identities = 88/90 (97%), Positives = 89/90 (98%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFSGIILKEENKDN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSGIILKEENKDNKGSTEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETKIR Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 90 >YP_009266576.1 ribosomal protein S15 (chloroplast) [Panax stipuleanatus] ANK78388.1 ribosomal protein S15 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78474.1 ribosomal protein S15 (chloroplast) [Panax stipuleanatus] Length = 90 Score = 174 bits (441), Expect = 4e-54 Identities = 88/90 (97%), Positives = 89/90 (98%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFSGIILKEENKDN+GSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSGIILKEENKDNKGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETK R Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKTR 90 >YP_008814914.1 ribosomal protein S15 (chloroplast) [Aralia undulata] AGG39014.1 ribosomal protein S15 (chloroplast) [Aralia undulata] ANS72001.1 ribosomal protein S15 (chloroplast) [Aralia elata] Length = 90 Score = 172 bits (435), Expect = 3e-53 Identities = 87/90 (96%), Positives = 88/90 (97%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEENKDN+GSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENKDNKGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETK R Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKTR 90 >YP_008815088.1 ribosomal protein S15 (chloroplast) [Metapanax delavayi] YP_008815262.1 ribosomal protein S15 (chloroplast) [Kalopanax septemlobus] YP_009122783.1 ribosomal protein S15 (chloroplast) [Dendropanax dentiger] YP_009159596.1 ribosomal protein S15 (chloroplast) [Dendropanax morbifer] YP_009161737.1 ribosomal protein S15 (chloroplast) [Fatsia japonica] AGG39188.1 ribosomal protein S15 (chloroplast) [Metapanax delavayi] AGG39362.1 ribosomal protein S15 (chloroplast) [Kalopanax septemlobus] AJK29904.1 ribosomal protein S15 (chloroplast) [Dendropanax dentiger] AKQ20786.1 ribosomal protein S15 (chloroplast) [Dendropanax morbifer] AKS11012.1 ribosomal protein S15 (chloroplast) [Fatsia japonica] ANS71827.1 ribosomal protein S15 (chloroplast) [Eleutherococcus sessiliflorus] ANS71914.1 ribosomal protein S15 (chloroplast) [Eleutherococcus gracilistylus] Length = 90 Score = 169 bits (429), Expect = 3e-52 Identities = 86/90 (95%), Positives = 87/90 (96%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEENKDN+GSAEFQVVS TNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENKDNKGSAEFQVVSLTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETK R Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKTR 90 >YP_008815001.1 ribosomal protein S15 (chloroplast) [Brassaiopsis hainla] AGG39101.1 ribosomal protein S15 (chloroplast) [Brassaiopsis hainla] Length = 90 Score = 169 bits (429), Expect = 3e-52 Identities = 86/90 (95%), Positives = 87/90 (96%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEENKDN+GSAEFQVVS TNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSSIILKEENKDNKGSAEFQVVSLTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETK R Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKTR 90 >YP_008815175.1 ribosomal protein S15 (chloroplast) [Schefflera delavayi] YP_009241110.1 ribosomal protein S15 (chloroplast) [Schefflera heptaphylla] AGG39275.1 ribosomal protein S15 (chloroplast) [Schefflera delavayi] AMK46210.1 ribosomal protein S15 (chloroplast) [Schefflera heptaphylla] Length = 90 Score = 168 bits (425), Expect = 1e-51 Identities = 85/90 (94%), Positives = 86/90 (95%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS I LKEENKDN+GSAEFQVVS TNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIFLKEENKDNKGSAEFQVVSLTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETK R Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKTR 90 >YP_004935610.1 ribosomal protein S15 (chloroplast) [Eleutherococcus senticosus] AEO92676.1 ribosomal protein S15 (chloroplast) [Eleutherococcus senticosus] Length = 90 Score = 168 bits (425), Expect = 1e-51 Identities = 85/90 (94%), Positives = 86/90 (95%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEENKDN+GSAEFQVV TNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENKDNKGSAEFQVVGLTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETKIR 282 QRLLAYLSKKNRVRYKELIGRLDIRETK R Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLDIRETKTR 90 >YP_009338480.1 ribosomal protein S15 (chloroplast) [Pterygopleurum neurophyllum] ANK36575.1 ribosomal protein S15 (chloroplast) [Pterygopleurum neurophyllum] Length = 90 Score = 167 bits (422), Expect = 3e-51 Identities = 84/88 (95%), Positives = 86/88 (97%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DNRGS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENEDNRGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIGRL+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLEIRETK 88 >AKZ24289.1 ribosomal protein S15 (plastid) [Cicuta maculata] Length = 90 Score = 166 bits (419), Expect = 8e-51 Identities = 83/88 (94%), Positives = 86/88 (97%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENEDNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIGRL+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLEIRETK 88 >YP_009331746.1 ribosomal protein S15 (chloroplast) [Arracacia xanthorrhiza] APH07315.1 ribosomal protein S15 (chloroplast) [Arracacia xanthorrhiza] Length = 90 Score = 164 bits (416), Expect = 2e-50 Identities = 82/88 (93%), Positives = 86/88 (97%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENEDNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIG+L+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGKLEIRETK 88 >YP_009186310.1 ribosomal protein S15 (chloroplast) [Ostericum grosseserratum] YP_009232803.1 ribosomal protein S15 (chloroplast) [Angelica acutiloba] YP_009232888.1 ribosomal protein S15 (chloroplast) [Angelica dahurica] YP_009233057.1 ribosomal protein S15 (chloroplast) [Ligusticum tenuissimum] YP_009243622.1 ribosomal protein S15 (chloroplast) [Coriandrum sativum] AKS03673.1 ribosomal protein S15 (chloroplast) [Coriandrum sativum] AKZ24290.1 ribosomal protein S15 (plastid) [Conium maculatum] AKZ24291.1 ribosomal protein S15 (plastid) [Zizia aurea] ALO71645.1 ribosomal protein S15 (chloroplast) [Ostericum grosseserratum] AMA97855.1 ribosomal protein S15 (chloroplast) [Angelica acutiloba] AMA97941.1 ribosomal protein S15 (chloroplast) [Angelica dahurica] AMA98112.1 ribosomal protein S15 (chloroplast) [Ligusticum tenuissimum] Length = 90 Score = 164 bits (415), Expect = 3e-50 Identities = 82/88 (93%), Positives = 86/88 (97%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENEDNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIG+L+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGQLEIRETK 88 >YP_009155269.1 ribosomal protein S15 (plastid) [Pastinaca pimpinellifolia] AIU99078.1 ribosomal protein S15 (plastid) [Pastinaca pimpinellifolia] Length = 92 Score = 164 bits (415), Expect = 4e-50 Identities = 82/88 (93%), Positives = 86/88 (97%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENEDNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIG+L+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGQLEIRETK 88 >ALN96868.1 ribosomal protein S15 (chloroplast) [Angelica decursiva] Length = 90 Score = 164 bits (414), Expect = 5e-50 Identities = 82/88 (93%), Positives = 85/88 (96%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENEDNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIG L+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGELEIRETK 88 >YP_009235937.1 ribosomal protein S15 (chloroplast) [Foeniculum vulgare] AMD83973.1 ribosomal protein S15 (chloroplast) [Foeniculum vulgare] Length = 90 Score = 162 bits (411), Expect = 1e-49 Identities = 82/88 (93%), Positives = 85/88 (96%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKN FS IILKEEN+DN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNTFSAIILKEENEDNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIGRL+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLEIRETK 88 >ANS72171.1 ribosomal protein S15 (chloroplast) [Ledebouriella seseloides] Length = 90 Score = 162 bits (410), Expect = 2e-49 Identities = 81/88 (92%), Positives = 85/88 (96%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENEDNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLS KNRVRYKELIG+L+IRETK Sbjct: 61 QRLLAYLSNKNRVRYKELIGQLEIRETK 88 >ANS72088.1 ribosomal protein S15 (chloroplast) [Glehnia littoralis] Length = 90 Score = 162 bits (409), Expect = 3e-49 Identities = 81/88 (92%), Positives = 85/88 (96%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DN+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPFSAIILKEENEDNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLL YLSKKNRVRYKELIG+L+IRETK Sbjct: 61 QRLLDYLSKKNRVRYKELIGQLEIRETK 88 >YP_009338313.1 ribosomal protein S15 (chloroplast) [Pleurospermum camtschaticum] ANK36408.1 ribosomal protein S15 (chloroplast) [Pleurospermum camtschaticum] Length = 90 Score = 161 bits (408), Expect = 4e-49 Identities = 81/88 (92%), Positives = 85/88 (96%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNPFS IILKEEN+DN+GS E+QVVSFTNRIRRLTSHLELHK DYLSQRGLRKILGKR Sbjct: 1 MIKNPFSVIILKEENEDNKGSVEYQVVSFTNRIRRLTSHLELHKNDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIGRL+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLEIRETK 88 >YP_004222703.1 ribosomal protein S15 (chloroplast) [Anthriscus cerefolium] ADD13695.1 ribosomal protein S15 (chloroplast) [Anthriscus cerefolium] Length = 90 Score = 161 bits (408), Expect = 4e-49 Identities = 81/88 (92%), Positives = 85/88 (96%) Frame = +1 Query: 13 MIKNPFSGIILKEENKDNRGSAEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 192 MIKNP S IILKEEN++N+GS EFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR Sbjct: 1 MIKNPLSAIILKEENENNKGSVEFQVVSFTNRIRRLTSHLELHKKDYLSQRGLRKILGKR 60 Query: 193 QRLLAYLSKKNRVRYKELIGRLDIRETK 276 QRLLAYLSKKNRVRYKELIGRL+IRETK Sbjct: 61 QRLLAYLSKKNRVRYKELIGRLEIRETK 88