BLASTX nr result
ID: Panax24_contig00022397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022397 (514 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018855103.1 PREDICTED: WD repeat-containing protein 75-like, ... 67 3e-11 XP_002533224.1 PREDICTED: WD repeat-containing protein 75 [Ricin... 69 2e-10 XP_012075112.1 PREDICTED: WD repeat-containing protein 75 isofor... 68 4e-10 XP_018850745.1 PREDICTED: WD repeat-containing protein 75 [Jugla... 67 5e-10 XP_017247838.1 PREDICTED: WD repeat-containing protein 75 [Daucu... 67 1e-09 XP_008223768.1 PREDICTED: WD repeat-containing protein 75 [Prunu... 67 1e-09 KZM98893.1 hypothetical protein DCAR_013745 [Daucus carota subsp... 67 1e-09 XP_010276147.1 PREDICTED: WD repeat-containing protein 75 [Nelum... 66 1e-09 XP_019160594.1 PREDICTED: WD repeat-containing protein 75 [Ipomo... 66 2e-09 GAV59567.1 WD40 domain-containing protein [Cephalotus follicularis] 66 2e-09 XP_010525723.1 PREDICTED: WD repeat-containing protein 75 [Taren... 66 2e-09 XP_006381788.1 transducin family protein [Populus trichocarpa] E... 65 3e-09 XP_012075113.1 PREDICTED: WD repeat-containing protein 75 isofor... 65 3e-09 XP_017982448.1 PREDICTED: WD repeat-containing protein 75 [Theob... 65 3e-09 EOY31860.1 Transducin/WD40 repeat-like superfamily protein [Theo... 65 3e-09 CAN69125.1 hypothetical protein VITISV_008194 [Vitis vinifera] 65 4e-09 XP_009371353.1 PREDICTED: WD repeat-containing protein 75-like i... 65 5e-09 XP_009371351.1 PREDICTED: WD repeat-containing protein 75-like i... 65 5e-09 XP_002266770.1 PREDICTED: WD repeat-containing protein 75 isofor... 65 5e-09 XP_010660305.1 PREDICTED: WD repeat-containing protein 75 isofor... 65 5e-09 >XP_018855103.1 PREDICTED: WD repeat-containing protein 75-like, partial [Juglans regia] XP_018855117.1 PREDICTED: WD repeat-containing protein 75-like, partial [Juglans regia] Length = 139 Score = 67.4 bits (163), Expect = 3e-11 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F G SEYL+S SRGS PQLS+WSMSKLS+SWSYKLH E Sbjct: 47 FAGNSEYLVSVSRGSKPQLSIWSMSKLSLSWSYKLHIE 84 >XP_002533224.1 PREDICTED: WD repeat-containing protein 75 [Ricinus communis] EEF29164.1 wd40 protein, putative [Ricinus communis] Length = 807 Score = 68.9 bits (167), Expect = 2e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F+GKSEYL SAS GS PQLSVWSMSKLSMSWSY+LH E Sbjct: 584 FVGKSEYLASASLGSKPQLSVWSMSKLSMSWSYRLHVE 621 >XP_012075112.1 PREDICTED: WD repeat-containing protein 75 isoform X1 [Jatropha curcas] KDP35363.1 hypothetical protein JCGZ_10347 [Jatropha curcas] Length = 817 Score = 67.8 bits (164), Expect = 4e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTEG 385 F+GKSEYL+S S GS PQLSVWSMSKLS+SWSY LH EG Sbjct: 587 FVGKSEYLVSVSWGSKPQLSVWSMSKLSISWSYGLHVEG 625 >XP_018850745.1 PREDICTED: WD repeat-containing protein 75 [Juglans regia] Length = 813 Score = 67.4 bits (163), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F G SEYL+S SRGS PQLS+WSMSKLS+SWSYKLH E Sbjct: 587 FAGNSEYLVSVSRGSKPQLSIWSMSKLSLSWSYKLHIE 624 >XP_017247838.1 PREDICTED: WD repeat-containing protein 75 [Daucus carota subsp. sativus] Length = 806 Score = 66.6 bits (161), Expect = 1e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 FIGKS+YL+SASRGS PQLSVWS+S++ +SWSYKLH E Sbjct: 584 FIGKSDYLVSASRGSEPQLSVWSLSRMCVSWSYKLHIE 621 >XP_008223768.1 PREDICTED: WD repeat-containing protein 75 [Prunus mume] Length = 812 Score = 66.6 bits (161), Expect = 1e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F GKSEYL+S S+GS PQLSVWSMSKLS SWSYKLH E Sbjct: 585 FAGKSEYLVSVSQGSKPQLSVWSMSKLSESWSYKLHIE 622 >KZM98893.1 hypothetical protein DCAR_013745 [Daucus carota subsp. sativus] Length = 875 Score = 66.6 bits (161), Expect = 1e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 FIGKS+YL+SASRGS PQLSVWS+S++ +SWSYKLH E Sbjct: 653 FIGKSDYLVSASRGSEPQLSVWSLSRMCVSWSYKLHIE 690 >XP_010276147.1 PREDICTED: WD repeat-containing protein 75 [Nelumbo nucifera] Length = 812 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F+G+SEYL+S S+G PQLSVWSMSKLS+SWSYKLH E Sbjct: 586 FVGRSEYLVSVSQGLKPQLSVWSMSKLSISWSYKLHAE 623 >XP_019160594.1 PREDICTED: WD repeat-containing protein 75 [Ipomoea nil] Length = 809 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTEGHRGVNEGGS 412 FIGKSEYL+S+S+GS PQ+SVWSMSKLS+SWS K+H E +G S Sbjct: 584 FIGKSEYLVSSSQGSNPQVSVWSMSKLSISWSCKIHAEAVSCAIDGSS 631 >GAV59567.1 WD40 domain-containing protein [Cephalotus follicularis] Length = 811 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F+G SEYL+S SRGS PQLSVWS+SKLS+SWSYKL+ E Sbjct: 584 FVGNSEYLVSVSRGSKPQLSVWSLSKLSLSWSYKLNVE 621 >XP_010525723.1 PREDICTED: WD repeat-containing protein 75 [Tarenaya hassleriana] Length = 814 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F+GKSE+L++AS GS PQLSVW+MSKLS+SWSY++H E Sbjct: 583 FVGKSEFLVAASHGSTPQLSVWNMSKLSLSWSYRIHME 620 >XP_006381788.1 transducin family protein [Populus trichocarpa] ERP59585.1 transducin family protein [Populus trichocarpa] Length = 812 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F GKSEYL+SAS GS PQLS+WSMSKLS+SWSY LH E Sbjct: 588 FAGKSEYLVSASWGSKPQLSIWSMSKLSVSWSYMLHVE 625 >XP_012075113.1 PREDICTED: WD repeat-containing protein 75 isoform X2 [Jatropha curcas] Length = 813 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F+GKSEYL+S S GS PQLSVWSMSKLS+SWSY LH E Sbjct: 587 FVGKSEYLVSVSWGSKPQLSVWSMSKLSISWSYGLHVE 624 >XP_017982448.1 PREDICTED: WD repeat-containing protein 75 [Theobroma cacao] Length = 812 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F+G+S+ L++ASRGS PQLSVWSMSKLS+SWSYKL TE Sbjct: 587 FVGRSDNLVAASRGSKPQLSVWSMSKLSLSWSYKLRTE 624 >EOY31860.1 Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 812 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F+G+S+ L++ASRGS PQLSVWSMSKLS+SWSYKL TE Sbjct: 587 FVGRSDNLVAASRGSKPQLSVWSMSKLSLSWSYKLRTE 624 >CAN69125.1 hypothetical protein VITISV_008194 [Vitis vinifera] Length = 407 Score = 64.7 bits (156), Expect = 4e-09 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTEGHRGVNEG 406 FIGKSEYL+SASRGS QLS+WS+SKLS SWSYKL E V +G Sbjct: 178 FIGKSEYLVSASRGSKSQLSLWSLSKLSESWSYKLQAEAVACVMDG 223 >XP_009371353.1 PREDICTED: WD repeat-containing protein 75-like isoform X2 [Pyrus x bretschneideri] XP_009371355.1 PREDICTED: WD repeat-containing protein 75-like isoform X2 [Pyrus x bretschneideri] Length = 791 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F GKSEYL+S ++GS PQLSVWSMS+LS SWSYKLH E Sbjct: 586 FAGKSEYLVSVTKGSKPQLSVWSMSELSESWSYKLHVE 623 >XP_009371351.1 PREDICTED: WD repeat-containing protein 75-like isoform X1 [Pyrus x bretschneideri] XP_009371354.1 PREDICTED: WD repeat-containing protein 75-like isoform X1 [Pyrus x bretschneideri] XP_018506247.1 PREDICTED: WD repeat-containing protein 75-like isoform X1 [Pyrus x bretschneideri] XP_018506248.1 PREDICTED: WD repeat-containing protein 75-like isoform X1 [Pyrus x bretschneideri] Length = 797 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTE 382 F GKSEYL+S ++GS PQLSVWSMS+LS SWSYKLH E Sbjct: 586 FAGKSEYLVSVTKGSKPQLSVWSMSELSESWSYKLHVE 623 >XP_002266770.1 PREDICTED: WD repeat-containing protein 75 isoform X2 [Vitis vinifera] CBI33488.3 unnamed protein product, partial [Vitis vinifera] Length = 815 Score = 64.7 bits (156), Expect = 5e-09 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTEGHRGVNEG 406 FIGKSEYL+SASRGS QLS+WS+SKLS SWSYKL E V +G Sbjct: 586 FIGKSEYLVSASRGSKSQLSLWSLSKLSESWSYKLQAEAVACVMDG 631 >XP_010660305.1 PREDICTED: WD repeat-containing protein 75 isoform X1 [Vitis vinifera] XP_010660306.1 PREDICTED: WD repeat-containing protein 75 isoform X1 [Vitis vinifera] XP_010660307.1 PREDICTED: WD repeat-containing protein 75 isoform X1 [Vitis vinifera] Length = 816 Score = 64.7 bits (156), Expect = 5e-09 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +2 Query: 269 FIGKSEYLISASRGSIPQLSVWSMSKLSMSWSYKLHTEGHRGVNEG 406 FIGKSEYL+SASRGS QLS+WS+SKLS SWSYKL E V +G Sbjct: 586 FIGKSEYLVSASRGSKSQLSLWSLSKLSESWSYKLQAEAVACVMDG 631