BLASTX nr result
ID: Panax24_contig00022355
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022355 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018814633.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 72 4e-12 XP_017220818.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 71 8e-12 XP_017220817.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 71 8e-12 KZM83883.1 hypothetical protein DCAR_028695 [Daucus carota subsp... 71 8e-12 ONH98059.1 hypothetical protein PRUPE_7G226000 [Prunus persica] 69 5e-11 XP_007204677.1 hypothetical protein PRUPE_ppa000309mg [Prunus pe... 69 5e-11 ONH98058.1 hypothetical protein PRUPE_7G226000 [Prunus persica] 69 5e-11 XP_017182421.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 67 2e-10 GAV78419.1 WD40 domain-containing protein/U-box domain-containin... 66 3e-10 XP_008242573.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 66 5e-10 XP_011464890.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 65 6e-10 XP_018502155.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 65 6e-10 XP_017237523.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 65 8e-10 KZN01724.1 hypothetical protein DCAR_010478 [Daucus carota subsp... 65 8e-10 EOY30732.1 Transducin/WD40 repeat-like superfamily protein [Theo... 64 2e-09 XP_017982863.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 63 4e-09 XP_015571663.1 PREDICTED: putative E3 ubiquitin-protein ligase L... 62 1e-08 EEF48225.1 F-box and wd40 domain protein, putative [Ricinus comm... 62 1e-08 OMO58191.1 hypothetical protein COLO4_34815 [Corchorus olitorius] 62 1e-08 GAU11683.1 hypothetical protein TSUD_74330 [Trifolium subterraneum] 60 4e-08 >XP_018814633.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Juglans regia] Length = 1353 Score = 71.6 bits (174), Expect = 4e-12 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 PN S MP +SP+SVI QAT+D T+ EL LAI NLCMSE+LKESEMAVL+IE Sbjct: 498 PNMKSVMPSSSPNSVISQATIDGTMSELRLAITNLCMSEVLKESEMAVLQIE 549 >XP_017220818.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform X2 [Daucus carota subsp. sativus] Length = 1324 Score = 70.9 bits (172), Expect = 8e-12 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P+FS+G PLASPDSVI QAT D VGEL AI+ L MSEILKESEMAVL IE Sbjct: 472 PSFSNGAPLASPDSVISQATFDGAVGELRHAIETLSMSEILKESEMAVLWIE 523 >XP_017220817.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform X1 [Daucus carota subsp. sativus] Length = 1326 Score = 70.9 bits (172), Expect = 8e-12 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P+FS+G PLASPDSVI QAT D VGEL AI+ L MSEILKESEMAVL IE Sbjct: 472 PSFSNGAPLASPDSVISQATFDGAVGELRHAIETLSMSEILKESEMAVLWIE 523 >KZM83883.1 hypothetical protein DCAR_028695 [Daucus carota subsp. sativus] Length = 1861 Score = 70.9 bits (172), Expect = 8e-12 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P+FS+G PLASPDSVI QAT D VGEL AI+ L MSEILKESEMAVL IE Sbjct: 422 PSFSNGAPLASPDSVISQATFDGAVGELRHAIETLSMSEILKESEMAVLWIE 473 >ONH98059.1 hypothetical protein PRUPE_7G226000 [Prunus persica] Length = 985 Score = 68.6 bits (166), Expect = 5e-11 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P S MPL SPDSVI QA++D VGEL +I NLCMSEILKESE+AVLRIE Sbjct: 134 PVVKSIMPLTSPDSVISQASLDGAVGELRHSITNLCMSEILKESELAVLRIE 185 >XP_007204677.1 hypothetical protein PRUPE_ppa000309mg [Prunus persica] Length = 1300 Score = 68.6 bits (166), Expect = 5e-11 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P S MPL SPDSVI QA++D VGEL +I NLCMSEILKESE+AVLRIE Sbjct: 489 PVVKSIMPLTSPDSVISQASLDGAVGELRHSITNLCMSEILKESELAVLRIE 540 >ONH98058.1 hypothetical protein PRUPE_7G226000 [Prunus persica] Length = 1340 Score = 68.6 bits (166), Expect = 5e-11 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P S MPL SPDSVI QA++D VGEL +I NLCMSEILKESE+AVLRIE Sbjct: 489 PVVKSIMPLTSPDSVISQASLDGAVGELRHSITNLCMSEILKESELAVLRIE 540 >XP_017182421.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus domestica] Length = 1348 Score = 66.6 bits (161), Expect = 2e-10 Identities = 36/46 (78%), Positives = 36/46 (78%) Frame = -3 Query: 354 MPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 MP SPDSVI Q D VGEL LAI NLCMSEILKESEMAVLRIE Sbjct: 500 MPSTSPDSVITQGGFDGAVGELRLAITNLCMSEILKESEMAVLRIE 545 >GAV78419.1 WD40 domain-containing protein/U-box domain-containing protein [Cephalotus follicularis] Length = 1007 Score = 66.2 bits (160), Expect = 3e-10 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P S MP SPDS+I QAT+D TV EL AI +LCMSE LKESEMAVLRIE Sbjct: 155 PMLGSMMPATSPDSLISQATLDGTVSELRHAITDLCMSETLKESEMAVLRIE 206 >XP_008242573.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN [Prunus mume] Length = 1340 Score = 65.9 bits (159), Expect = 5e-10 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P S MP SPDSVI Q ++D VGEL AI NLCMSEILKESE+AVLRIE Sbjct: 489 PVVKSIMPSTSPDSVISQVSLDGAVGELRHAITNLCMSEILKESELAVLRIE 540 >XP_011464890.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 [Fragaria vesca subsp. vesca] XP_011464891.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 [Fragaria vesca subsp. vesca] Length = 1337 Score = 65.5 bits (158), Expect = 6e-10 Identities = 36/56 (64%), Positives = 40/56 (71%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIEYLFI 205 P S MP SP SVI QA +D V EL +AI NLCMSEILKESEMAVLRIE ++ Sbjct: 490 PMVKSIMPSTSPVSVISQAAIDSAVSELRIAITNLCMSEILKESEMAVLRIERFWL 545 >XP_018502155.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN [Pyrus x bretschneideri] Length = 1345 Score = 65.5 bits (158), Expect = 6e-10 Identities = 36/52 (69%), Positives = 38/52 (73%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P + MP SPDSVI Q D VGEL LAI NLCMSEILKESEMAVL+IE Sbjct: 494 PVLKAIMPSTSPDSVITQGGFDGAVGELRLAITNLCMSEILKESEMAVLQIE 545 >XP_017237523.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Daucus carota subsp. sativus] Length = 950 Score = 65.1 bits (157), Expect = 8e-10 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 PNF+S SPDSVI Q +D +V EL +AIKNLCMSEILKESEMAVL IE Sbjct: 100 PNFNSMTRSVSPDSVIGQVNIDSSVVELRVAIKNLCMSEILKESEMAVLWIE 151 >KZN01724.1 hypothetical protein DCAR_010478 [Daucus carota subsp. sativus] Length = 1004 Score = 65.1 bits (157), Expect = 8e-10 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 PNF+S SPDSVI Q +D +V EL +AIKNLCMSEILKESEMAVL IE Sbjct: 100 PNFNSMTRSVSPDSVIGQVNIDSSVVELRVAIKNLCMSEILKESEMAVLWIE 151 >EOY30732.1 Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 1332 Score = 64.3 bits (155), Expect = 2e-09 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P S +P SP+SVI QATMD T+ EL AI NLCMSEILKESE AVL+IE Sbjct: 480 PMVKSIVPATSPNSVISQATMDRTINELRQAITNLCMSEILKESERAVLQIE 531 >XP_017982863.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN [Theobroma cacao] Length = 1333 Score = 63.2 bits (152), Expect = 4e-09 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = -3 Query: 372 PNFSSGMPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P S +P SP+SVI QATMD T+ EL AI NLCMSEILKESE AVL++E Sbjct: 481 PMVKSIVPATSPNSVISQATMDRTINELRQAITNLCMSEILKESERAVLQME 532 >XP_015571663.1 PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Ricinus communis] Length = 1249 Score = 62.0 bits (149), Expect = 1e-08 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = -3 Query: 372 PNFSSGM--PLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 PNF S + P+ SP+SVI Q+ +D T+ EL AI +LCMSEIL ESEMAVLRIE Sbjct: 483 PNFKSTIISPVTSPNSVISQSAIDSTMSELRQAITDLCMSEILSESEMAVLRIE 536 >EEF48225.1 F-box and wd40 domain protein, putative [Ricinus communis] Length = 1268 Score = 62.0 bits (149), Expect = 1e-08 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = -3 Query: 372 PNFSSGM--PLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 PNF S + P+ SP+SVI Q+ +D T+ EL AI +LCMSEIL ESEMAVLRIE Sbjct: 502 PNFKSTIISPVTSPNSVISQSAIDSTMSELRQAITDLCMSEILSESEMAVLRIE 555 >OMO58191.1 hypothetical protein COLO4_34815 [Corchorus olitorius] Length = 1294 Score = 62.0 bits (149), Expect = 1e-08 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = -3 Query: 351 PLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIE 217 P SP+SVI QATMD T+ EL AI NLCMSEILKESE AVL+IE Sbjct: 453 PSTSPNSVISQATMDRTINELRQAITNLCMSEILKESETAVLQIE 497 >GAU11683.1 hypothetical protein TSUD_74330 [Trifolium subterraneum] Length = 1337 Score = 60.5 bits (145), Expect = 4e-08 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -3 Query: 354 MPLASPDSVICQATMDCTVGEL*LAIKNLCMSEILKESEMAVLRIEYLF 208 MP ASP+SVI QAT+D V EL AI NL MSEIL+ESEMAVL+IE L+ Sbjct: 490 MPSASPNSVIMQATVDGMVSELRCAINNLYMSEILQESEMAVLQIEKLW 538