BLASTX nr result
ID: Panax24_contig00022306
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022306 (1021 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018825919.1 PREDICTED: protein root UVB sensitive 5 isoform X... 61 9e-07 XP_018825918.1 PREDICTED: protein root UVB sensitive 5 isoform X... 61 9e-07 XP_018825917.1 PREDICTED: protein root UVB sensitive 5 isoform X... 61 9e-07 XP_007140352.1 hypothetical protein PHAVU_008G104800g [Phaseolus... 60 2e-06 CBI30394.3 unnamed protein product, partial [Vitis vinifera] 60 3e-06 XP_010654157.1 PREDICTED: protein root UVB sensitive 5 [Vitis vi... 60 3e-06 GAV75480.1 DUF647 domain-containing protein [Cephalotus follicul... 59 5e-06 XP_020102494.1 protein root UVB sensitive 5 isoform X11 [Ananas ... 58 9e-06 XP_020102491.1 protein root UVB sensitive 5 isoform X9 [Ananas c... 58 9e-06 XP_008243797.1 PREDICTED: protein root UVB sensitive 5 [Prunus m... 58 9e-06 XP_020102490.1 protein root UVB sensitive 5 isoform X8 [Ananas c... 58 1e-05 >XP_018825919.1 PREDICTED: protein root UVB sensitive 5 isoform X3 [Juglans regia] Length = 479 Score = 61.2 bits (147), Expect = 9e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYLEY++LQF TN+TAWI HALVTSSLLKA Sbjct: 125 GSVSDDYLEYMLLQFPTNVTAWICHALVTSSLLKA 159 >XP_018825918.1 PREDICTED: protein root UVB sensitive 5 isoform X2 [Juglans regia] Length = 493 Score = 61.2 bits (147), Expect = 9e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYLEY++LQF TN+TAWI HALVTSSLLKA Sbjct: 125 GSVSDDYLEYMLLQFPTNVTAWICHALVTSSLLKA 159 >XP_018825917.1 PREDICTED: protein root UVB sensitive 5 isoform X1 [Juglans regia] Length = 499 Score = 61.2 bits (147), Expect = 9e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYLEY++LQF TN+TAWI HALVTSSLLKA Sbjct: 125 GSVSDDYLEYMLLQFPTNVTAWICHALVTSSLLKA 159 >XP_007140352.1 hypothetical protein PHAVU_008G104800g [Phaseolus vulgaris] ESW12346.1 hypothetical protein PHAVU_008G104800g [Phaseolus vulgaris] Length = 390 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 899 FSTSNAGLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 F + +AG VSDDYL Y++LQF TN+T WI H LVTSSLLKA Sbjct: 9 FVSHDAGSVSDDYLHYMLLQFPTNVTGWICHTLVTSSLLKA 49 >CBI30394.3 unnamed protein product, partial [Vitis vinifera] Length = 462 Score = 59.7 bits (143), Expect = 3e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYLEY++LQF TN+TAWI H LVTSSLLKA Sbjct: 87 GSVSDDYLEYMLLQFPTNVTAWICHTLVTSSLLKA 121 >XP_010654157.1 PREDICTED: protein root UVB sensitive 5 [Vitis vinifera] Length = 502 Score = 59.7 bits (143), Expect = 3e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYLEY++LQF TN+TAWI H LVTSSLLKA Sbjct: 124 GSVSDDYLEYMLLQFPTNVTAWICHTLVTSSLLKA 158 >GAV75480.1 DUF647 domain-containing protein [Cephalotus follicularis] Length = 490 Score = 58.9 bits (141), Expect = 5e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYL+Y++LQF TNIT WI HALVTSSLLKA Sbjct: 110 GSVSDDYLQYMLLQFPTNITGWICHALVTSSLLKA 144 >XP_020102494.1 protein root UVB sensitive 5 isoform X11 [Ananas comosus] Length = 468 Score = 58.2 bits (139), Expect = 9e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYLEY++LQF TN+T WI H LVTSSLLKA Sbjct: 111 GSVSDDYLEYMLLQFPTNVTGWICHTLVTSSLLKA 145 >XP_020102491.1 protein root UVB sensitive 5 isoform X9 [Ananas comosus] Length = 494 Score = 58.2 bits (139), Expect = 9e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYLEY++LQF TN+T WI H LVTSSLLKA Sbjct: 111 GSVSDDYLEYMLLQFPTNVTGWICHTLVTSSLLKA 145 >XP_008243797.1 PREDICTED: protein root UVB sensitive 5 [Prunus mume] Length = 502 Score = 58.2 bits (139), Expect = 9e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +2 Query: 899 FSTSNAGLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 F G VSDDYL Y++LQF TN+TAWI H LVTSSLLKA Sbjct: 122 FPAGFPGSVSDDYLSYMLLQFPTNVTAWICHTLVTSSLLKA 162 >XP_020102490.1 protein root UVB sensitive 5 isoform X8 [Ananas comosus] Length = 510 Score = 58.2 bits (139), Expect = 1e-05 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 917 GLVSDDYLEYIMLQFLTNITAWIRHALVTSSLLKA 1021 G VSDDYLEY++LQF TN+T WI H LVTSSLLKA Sbjct: 111 GSVSDDYLEYMLLQFPTNVTGWICHTLVTSSLLKA 145