BLASTX nr result
ID: Panax24_contig00022127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022127 (435 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS67049.1 hypothetical protein M569_07727, partial [Genlisea au... 57 5e-07 XP_012838087.1 PREDICTED: reticulon-like protein B5 [Erythranthe... 55 2e-06 XP_015087019.1 PREDICTED: reticulon-like protein B5 [Solanum pen... 55 2e-06 XP_004247011.1 PREDICTED: reticulon-like protein B5 [Solanum lyc... 55 2e-06 XP_016541291.1 PREDICTED: reticulon-like protein B5 [Capsicum an... 55 2e-06 XP_017249001.1 PREDICTED: reticulon-like protein B6 [Daucus caro... 55 5e-06 >EPS67049.1 hypothetical protein M569_07727, partial [Genlisea aurea] Length = 222 Score = 57.0 bits (136), Expect = 5e-07 Identities = 23/38 (60%), Positives = 35/38 (92%) Frame = -2 Query: 431 KVDTYAEKAIGELKKRYNALDDRVLRKIPKIPFMKDNK 318 KVD+YAE+A ELKK+Y++LD+++L+K+PK+PF+ DNK Sbjct: 184 KVDSYAERAKAELKKQYSSLDEKLLQKLPKVPFLGDNK 221 >XP_012838087.1 PREDICTED: reticulon-like protein B5 [Erythranthe guttata] EYU36885.1 hypothetical protein MIMGU_mgv1a013116mg [Erythranthe guttata] Length = 230 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/40 (55%), Positives = 35/40 (87%) Frame = -2 Query: 431 KVDTYAEKAIGELKKRYNALDDRVLRKIPKIPFMKDNK*H 312 +VD+YA+KA +LK++Y+ LD++VL+K+PK+PF+ DNK H Sbjct: 191 QVDSYAQKAKAKLKRQYSTLDEKVLQKLPKVPFINDNKQH 230 >XP_015087019.1 PREDICTED: reticulon-like protein B5 [Solanum pennellii] Length = 244 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 35/38 (92%) Frame = -2 Query: 431 KVDTYAEKAIGELKKRYNALDDRVLRKIPKIPFMKDNK 318 +VDTYA+KA ELK++Y+ LD++VL+K+PK+PF+KD+K Sbjct: 205 QVDTYAQKAKKELKRQYSHLDEKVLQKLPKVPFVKDSK 242 >XP_004247011.1 PREDICTED: reticulon-like protein B5 [Solanum lycopersicum] Length = 244 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 35/38 (92%) Frame = -2 Query: 431 KVDTYAEKAIGELKKRYNALDDRVLRKIPKIPFMKDNK 318 +VDTYA+KA ELK++Y+ LD++VL+K+PK+PF+KD+K Sbjct: 205 QVDTYAQKAKKELKRQYSHLDEKVLQKLPKVPFVKDSK 242 >XP_016541291.1 PREDICTED: reticulon-like protein B5 [Capsicum annuum] Length = 253 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 35/38 (92%) Frame = -2 Query: 431 KVDTYAEKAIGELKKRYNALDDRVLRKIPKIPFMKDNK 318 +VDTYA+KA ELK++Y+ LD++VL+K+PK+PF+KD+K Sbjct: 214 QVDTYAQKAKKELKRQYSHLDEKVLQKLPKVPFVKDSK 251 >XP_017249001.1 PREDICTED: reticulon-like protein B6 [Daucus carota subsp. sativus] KZM95347.1 hypothetical protein DCAR_018589 [Daucus carota subsp. sativus] Length = 292 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/38 (68%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -2 Query: 428 VDTYAEKAIGELKKRYNALDDRVLRKIPKIP-FMKDNK 318 VD YA+KA G+LK++Y+ALDD+VLRK+PKIP F KD K Sbjct: 253 VDDYAKKATGKLKRQYDALDDKVLRKLPKIPSFRKDKK 290