BLASTX nr result
ID: Panax24_contig00022106
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00022106 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215316.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 6e-11 KZM88931.1 hypothetical protein DCAR_026006 [Daucus carota subsp... 67 7e-11 XP_017223747.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 7e-11 XP_017215315.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 7e-11 XP_017223746.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 9e-11 XP_012844390.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 1e-10 XP_006345777.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 1e-10 XP_006345776.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 2e-10 JAT67829.1 Biotin carboxyl carrier protein of acetyl-CoA carboxy... 66 2e-10 KJB66287.1 hypothetical protein B456_010G135200 [Gossypium raimo... 64 3e-10 XP_015875754.1 PREDICTED: biotin carboxyl carrier protein of ace... 65 5e-10 XP_012085782.1 PREDICTED: biotin carboxyl carrier protein of ace... 65 5e-10 KJB66288.1 hypothetical protein B456_010G135200 [Gossypium raimo... 64 6e-10 XP_012085781.1 PREDICTED: biotin carboxyl carrier protein of ace... 65 6e-10 XP_002284374.1 PREDICTED: biotin carboxyl carrier protein of ace... 65 7e-10 AGB07441.1 biotin carboxyl carrier protein [Persea americana] 65 7e-10 XP_009412715.1 PREDICTED: biotin carboxyl carrier protein of ace... 65 7e-10 NP_001234322.1 biotin carboxylase carrier protein [Solanum lycop... 65 7e-10 KJB66285.1 hypothetical protein B456_010G135200 [Gossypium raimo... 64 9e-10 CDP04187.1 unnamed protein product [Coffea canephora] 64 1e-09 >XP_017215316.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X2 [Daucus carota subsp. sativus] Length = 253 Score = 67.4 bits (163), Expect = 6e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPP 320 L+ LVDSRDIMELQLKQENCEVLIRKKEALPQPP Sbjct: 92 LIELVDSRDIMELQLKQENCEVLIRKKEALPQPP 125 >KZM88931.1 hypothetical protein DCAR_026006 [Daucus carota subsp. sativus] Length = 268 Score = 67.4 bits (163), Expect = 7e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPP 320 L+ LVDSRDIMELQLKQENCEVLIRKKEALPQPP Sbjct: 122 LIELVDSRDIMELQLKQENCEVLIRKKEALPQPP 155 >XP_017223747.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X2 [Daucus carota subsp. sativus] KZM82431.1 hypothetical protein DCAR_030000 [Daucus carota subsp. sativus] Length = 279 Score = 67.4 bits (163), Expect = 7e-11 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = +3 Query: 201 DMLKDGLLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPVQEV*HEP 356 D +K+ L++LVDSRDI+ELQLKQ CE+ IRKKEALPQPP AP Q + H P Sbjct: 112 DQVKN-LVKLVDSRDIVELQLKQLGCELTIRKKEALPQPPAPAPAQVMMHAP 162 >XP_017215315.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X1 [Daucus carota subsp. sativus] Length = 280 Score = 67.4 bits (163), Expect = 7e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPP 320 L+ LVDSRDIMELQLKQENCEVLIRKKEALPQPP Sbjct: 119 LIELVDSRDIMELQLKQENCEVLIRKKEALPQPP 152 >XP_017223746.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X1 [Daucus carota subsp. sativus] Length = 310 Score = 67.4 bits (163), Expect = 9e-11 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = +3 Query: 201 DMLKDGLLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPVQEV*HEP 356 D +K+ L++LVDSRDI+ELQLKQ CE+ IRKKEALPQPP AP Q + H P Sbjct: 143 DQVKN-LVKLVDSRDIVELQLKQLGCELTIRKKEALPQPPAPAPAQVMMHAP 193 >XP_012844390.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Erythranthe guttata] EYU31591.1 hypothetical protein MIMGU_mgv1a011799mg [Erythranthe guttata] Length = 270 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDI+EL+LKQ +CE+LIRKKEALPQPPV APV Sbjct: 109 LVKLVDSRDIVELELKQMDCELLIRKKEALPQPPVAAPV 147 >XP_006345777.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 285 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPVQ 338 L++LVDSRDI+ELQLKQ +CE+LIRKKEALPQPP AP Q Sbjct: 125 LVKLVDSRDIVELQLKQLDCEILIRKKEALPQPPAPAPAQ 164 >XP_006345776.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 316 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPVQ 338 L++LVDSRDI+ELQLKQ +CE+LIRKKEALPQPP AP Q Sbjct: 156 LVKLVDSRDIVELQLKQLDCEILIRKKEALPQPPAPAPAQ 195 >JAT67829.1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Anthurium amnicola] Length = 288 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDI+ELQLKQ+ CE++IRKKEALPQPP APV Sbjct: 124 LVKLVDSRDIIELQLKQQECELIIRKKEALPQPPAPAPV 162 >KJB66287.1 hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 161 Score = 63.9 bits (154), Expect = 3e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 222 LRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 +RLVDSRDI+ELQLKQ +CE++IRKKEALPQPP APV Sbjct: 1 MRLVDSRDIVELQLKQLDCELVIRKKEALPQPPSAAPV 38 >XP_015875754.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Ziziphus jujuba] Length = 285 Score = 65.1 bits (157), Expect = 5e-10 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPVQEV*HEP 356 L++LVDSRDI+ELQLKQ +CEV IRKKEALPQPP APV + H P Sbjct: 120 LVKLVDSRDIVELQLKQLDCEVTIRKKEALPQPPAPAPVAMM-HSP 164 >XP_012085782.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X2 [Jatropha curcas] XP_012085783.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X3 [Jatropha curcas] ADN52613.1 acetyl-CoA carboxylase BCCP subunit [Jatropha curcas] KDP26884.1 hypothetical protein JCGZ_18042 [Jatropha curcas] Length = 285 Score = 65.1 bits (157), Expect = 5e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDI+ELQLKQ +CEV+IRKKEALPQPP APV Sbjct: 121 LVKLVDSRDIVELQLKQLDCEVIIRKKEALPQPPSPAPV 159 >KJB66288.1 hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 201 Score = 63.9 bits (154), Expect = 6e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDI+ELQLKQ +CE++IRKKEALPQPP APV Sbjct: 40 LVKLVDSRDIVELQLKQLDCELVIRKKEALPQPPSAAPV 78 >XP_012085781.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic isoform X1 [Jatropha curcas] Length = 316 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDI+ELQLKQ +CEV+IRKKEALPQPP APV Sbjct: 152 LVKLVDSRDIVELQLKQLDCEVIIRKKEALPQPPSPAPV 190 >XP_002284374.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Vitis vinifera] CBI22297.3 unnamed protein product, partial [Vitis vinifera] Length = 270 Score = 64.7 bits (156), Expect = 7e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDIMEL+LKQ CE+LIRKKEALPQPP TA V Sbjct: 108 LVKLVDSRDIMELELKQLGCELLIRKKEALPQPPATASV 146 >AGB07441.1 biotin carboxyl carrier protein [Persea americana] Length = 281 Score = 64.7 bits (156), Expect = 7e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDI+ELQLKQ NCEV+IRKKEAL QPP APV Sbjct: 116 LVKLVDSRDIVELQLKQHNCEVIIRKKEALAQPPGPAPV 154 >XP_009412715.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Musa acuminata subsp. malaccensis] Length = 282 Score = 64.7 bits (156), Expect = 7e-10 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 +++LVDSRDI+ELQLKQ +CE++IRKKEALPQPP AP+ Sbjct: 126 IVKLVDSRDIVELQLKQNDCELIIRKKEALPQPPAPAPI 164 >NP_001234322.1 biotin carboxylase carrier protein [Solanum lycopersicum] AAO66472.1 biotin carboxylase carrier protein [Solanum lycopersicum] Length = 285 Score = 64.7 bits (156), Expect = 7e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPVQ 338 L++LVDSRD++ELQLKQ +CE+LIRKKEALPQPP P Q Sbjct: 123 LVKLVDSRDVVELQLKQFDCEILIRKKEALPQPPAPVPAQ 162 >KJB66285.1 hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 234 Score = 63.9 bits (154), Expect = 9e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDI+ELQLKQ +CE++IRKKEALPQPP APV Sbjct: 121 LVKLVDSRDIVELQLKQLDCELVIRKKEALPQPPSAAPV 159 >CDP04187.1 unnamed protein product [Coffea canephora] Length = 275 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +3 Query: 219 LLRLVDSRDIMELQLKQENCEVLIRKKEALPQPPVTAPV 335 L++LVDSRDI+ELQLKQ +CE+LIRKKEALP PP TAP+ Sbjct: 121 LVKLVDSRDIVELQLKQFDCELLIRKKEALPPPPSTAPI 159