BLASTX nr result
ID: Panax24_contig00021860
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00021860 (733 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017258086.1 PREDICTED: probable manganese-transporting ATPase... 68 2e-09 KZM92197.1 hypothetical protein DCAR_020438 [Daucus carota subsp... 68 2e-09 XP_017240328.1 PREDICTED: probable manganese-transporting ATPase... 67 6e-09 KJB81177.1 hypothetical protein B456_013G132500 [Gossypium raimo... 66 7e-09 KJB81178.1 hypothetical protein B456_013G132500 [Gossypium raimo... 66 7e-09 KJB81179.1 hypothetical protein B456_013G132500 [Gossypium raimo... 66 7e-09 KJB81180.1 hypothetical protein B456_013G132500 [Gossypium raimo... 66 7e-09 KJB81182.1 hypothetical protein B456_013G132500 [Gossypium raimo... 66 8e-09 XP_017610889.1 PREDICTED: probable manganese-transporting ATPase... 66 8e-09 XP_016704886.1 PREDICTED: probable manganese-transporting ATPase... 66 8e-09 XP_016675734.1 PREDICTED: probable manganese-transporting ATPase... 66 8e-09 XP_012462989.1 PREDICTED: probable manganese-transporting ATPase... 66 8e-09 KHG01823.1 hypothetical protein F383_22933 [Gossypium arboreum] 66 8e-09 XP_011091458.1 PREDICTED: probable manganese-transporting ATPase... 65 1e-08 XP_016463760.1 PREDICTED: probable manganese-transporting ATPase... 65 2e-08 XP_006384373.1 hypothetical protein POPTR_0004s14450g [Populus t... 65 2e-08 XP_019238551.1 PREDICTED: probable manganese-transporting ATPase... 65 3e-08 XP_016463581.1 PREDICTED: probable manganese-transporting ATPase... 65 3e-08 XP_009763607.1 PREDICTED: probable manganese-transporting ATPase... 65 3e-08 XP_009590998.1 PREDICTED: probable manganese-transporting ATPase... 65 3e-08 >XP_017258086.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Daucus carota subsp. sativus] XP_017258087.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Daucus carota subsp. sativus] Length = 1191 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS + GL ES +LETEMTKV Sbjct: 479 FAGKVDICCFDKTGTLTSDDMEFSGIGGLTESSDLETEMTKV 520 >KZM92197.1 hypothetical protein DCAR_020438 [Daucus carota subsp. sativus] Length = 1235 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/42 (80%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS + GL ES +LETEMTKV Sbjct: 523 FAGKVDICCFDKTGTLTSDDMEFSGIGGLTESSDLETEMTKV 564 >XP_017240328.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Daucus carota subsp. sativus] KZN00280.1 hypothetical protein DCAR_009034 [Daucus carota subsp. sativus] Length = 1191 Score = 66.6 bits (161), Expect = 6e-09 Identities = 34/42 (80%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS V GL ES +LETEMT V Sbjct: 479 FAGKVDICCFDKTGTLTSDDMEFSGVGGLTESSDLETEMTNV 520 >KJB81177.1 hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 607 Score = 66.2 bits (160), Expect = 7e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >KJB81178.1 hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 717 Score = 66.2 bits (160), Expect = 7e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >KJB81179.1 hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 843 Score = 66.2 bits (160), Expect = 7e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >KJB81180.1 hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 880 Score = 66.2 bits (160), Expect = 7e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >KJB81182.1 hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 1184 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >XP_017610889.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Gossypium arboreum] Length = 1185 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >XP_016704886.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Gossypium hirsutum] XP_016704887.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Gossypium hirsutum] Length = 1186 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >XP_016675734.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Gossypium hirsutum] XP_016675735.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Gossypium hirsutum] Length = 1186 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >XP_012462989.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Gossypium raimondii] XP_012462990.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Gossypium raimondii] KJB81176.1 hypothetical protein B456_013G132500 [Gossypium raimondii] KJB81181.1 hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 1186 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 523 >KHG01823.1 hypothetical protein F383_22933 [Gossypium arboreum] Length = 1188 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFS-EVGLIESLELETEMTKVSS 687 F KVDICCFDKTGTLTSDDMEFS VGL +S ELE++MTKV S Sbjct: 471 FAGKVDICCFDKTGTLTSDDMEFSGVVGLNDSSELESDMTKVPS 514 >XP_011091458.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Sesamum indicum] Length = 1184 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/42 (78%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS V GL +S +LETEM+KV Sbjct: 479 FAGKVDICCFDKTGTLTSDDMEFSGVGGLTDSEDLETEMSKV 520 >XP_016463760.1 PREDICTED: probable manganese-transporting ATPase PDR2, partial [Nicotiana tabacum] Length = 836 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS V GL +S +LE EMTKV Sbjct: 479 FAGKVDICCFDKTGTLTSDDMEFSGVGGLTDSEDLEKEMTKV 520 >XP_006384373.1 hypothetical protein POPTR_0004s14450g [Populus trichocarpa] ERP62170.1 hypothetical protein POPTR_0004s14450g [Populus trichocarpa] Length = 960 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEF-SEVGLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEF VGL ES +LE++MTKV Sbjct: 253 FAGKVDICCFDKTGTLTSDDMEFRGVVGLTESADLESDMTKV 294 >XP_019238551.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Nicotiana attenuata] OIT21655.1 putative manganese-transporting atpase pdr2 [Nicotiana attenuata] Length = 1177 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS V GL +S +LE EMTKV Sbjct: 479 FAGKVDICCFDKTGTLTSDDMEFSGVGGLTDSEDLEKEMTKV 520 >XP_016463581.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Nicotiana tabacum] Length = 1177 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS V GL +S +LE EMTKV Sbjct: 479 FAGKVDICCFDKTGTLTSDDMEFSGVGGLTDSEDLEKEMTKV 520 >XP_009763607.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Nicotiana sylvestris] Length = 1177 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS V GL +S +LE EMTKV Sbjct: 479 FAGKVDICCFDKTGTLTSDDMEFSGVGGLTDSEDLEKEMTKV 520 >XP_009590998.1 PREDICTED: probable manganese-transporting ATPase PDR2 [Nicotiana tomentosiformis] Length = 1177 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 559 FKSKVDICCFDKTGTLTSDDMEFSEV-GLIESLELETEMTKV 681 F KVDICCFDKTGTLTSDDMEFS V GL +S +LE EMTKV Sbjct: 479 FAGKVDICCFDKTGTLTSDDMEFSGVGGLTDSEDLEKEMTKV 520